@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0271: (2016-03-14 )
MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIPGTTFKGTNGDVAVDHYHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLQFYDNLIDELLKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNEQNIFVGMGYGQALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIGPSFAYTPHYPIDTDPKNVQAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIEDGDMELLASAKPDFMGVNYYQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKKVVNPFVKTTNWDWTIDPKGLQIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRIDYLSAHATAIRDAISDGVDMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTRIPKKSYYWYKQVIETNGADL

Atome Classification :

(72 SA) ...-......10........20........30........-----------40.--------.--.-..-..----------.50.--...-------....60........70........80........90.-.--......100.......110.......120.......130.......140.......150.......160.......170-----..-------...-----....--180-.....-...190-----------.....-----------...---200.......---210---....---.---..-220.......230...-.-...240......-.250.-.......--260.......270.--------.--------.....280.....-..290.......300.......310.......-320.-......330.....-..--------340........350..-.....360.......370.-.-.-..-...380.--....---.--.--390....-----.....----400.......410.-.-.....420.......430....-...440.......450-.......460.......470......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MEH-QKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWD-----------EYV--------R--I-PG-TT----------FKGT--NGD-------VAVDHYHRYKEDVKLMADAGLKAYRFSIAWTRIFPNG-K--GEVNEAGLQFYDNLIDELLKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNE-------QN-------IFV-----GMGY--GQ--ALHPP-KVSDP------------KRMYA-----------VNH---IANLANASVI---KAF---HEIV---P---DG-KIGPSFAYTPHYPIDT-D-PKNVQAADDAEE-LN-SY-FWMDMYA--FGRYPKAVWKYLEE--------N--------DIAPVIEDGDMEL-LASAKPDFMGVNYYQSATVAYNPLDGVGQNNE-MNFT-GKKGSTKETGVPGV-YK--------K-VVNPFVKTTNWDWT-IDPKGLQIALRRINSRY-A-L-P-IL-ITENGLG--EFDK---L--V--D--GEVN-----DDYRI----DYLSAHATAIRDAI-S-DGVDMLGYCTWSFTDLLSWLNG-YQKRYGFVYVDRDVED-DAPMTRIPKKSYYWYKQVIETNGADL
107 HHSearch 94.7142% -75 - C2 -2XHY BGLA_ECOLI A:[4-479] -----KKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICD-----------VLT--------G--G-AH-GVPREITKEVLPGKYY--PNH-------EAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKG-DE-AQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE-------IN-------NQRNWRAPLFGY--CCS-GVVYT-EHENPE-----------ETMYQ-----------VLH---HQFVASALAV---KAA---RRIN---P---EM-KVGCMLAMVPLYPYSC-N-PDDVMFAQESMR-E--RY-VFTDVQL--RGYYPSYVLNEWER--------R--------GFNIKMEDGDLDVLREGT-CDYLGFSYYMTNAVKAEGGT-----------F------------EG------------S-VPNPYVKASDWGWQ-IDPVGLRYALCELYERY-Q-R-P-LF-IVENGFG--AYDK---V--EE-D--GSIN-----DDYRI----DYLRAHIEEMKKAVTY-DGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGD-MSRSRKKSFNWYKEVIASNGEKL
25 PsiBlast_CBE 93.5838% -76 - C2 -2XHY BGLA_ECOLI C:[5-479] ------KLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREIT--------KEVL-PG-KY----------YPNH--E----------AVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDE--AQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE-------INNQRNWRAPLF-----GYCC--SG--VVYTE-HENPE------------ETMYQ-----------VLH---HQFVASALAV---KAA---RRIN---P---EM-KVGCMLAMVPLYPYSC-N-PDDVMFAQESMR--E-RY-VFTDVQL--RGYYPSYVLNEWER--------R--------GFNIKMEDGDLDV-LREGTCDYLGFSYYMTNAVK-------------------AEGG-----------G--------S-VPNPYVKASDWGWQ-IDPVGLRYALCELYERY-Q-R-P-LF-IVENGFG--AYDK---VE-E--D--GSIN-----DDYRI----DYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDG-TGDMSRSRKKSFNWYKEVIASNGEKL
28 PsiBlast_CBE 93.2840% -75 - C2 -4GPN ? B:[5-480] -------SKLPENFLWGGAVAAHQLEGGWQEGGKGISVAD-----------VMTAGRHGVARE--I-TA-GV----------LEGKYYPNH-------EAIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AEPNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEYGGFTNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQANYQE-------DFA-----PFTN--SG--IVYKE-GDDRE------------AIMYQ-----------AAH---YELVASARAV---KIG---HAIN---P---NL-NIGCMVAMCPIYPATC-N-PKDILMAQKAMQ--K-RY-YFADVHV--HGFYPEHIFKYWER--------K--------AIKVDFTERDKKD-LFEGTVDYIGFSYYMSFVI-----DAHRENNPYYDYL-ETEDLVK----------------------NPYVKASDWDWQ-IDPQGLRYALNWFTDMY-H-L-P-LF-IVQNGFG--AIDQ---VE-A--D--GMVH-----DDYRI----DYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDEG-KGTLKRSPKLSFNWYKEVIASNGDDI
4 PsiBlast_PDB 92.9140% -76 - C2 -4F79 ? A:[5-480] -------SKLPENFLWGGAVAAHQLEGGWQEGGKGISVAD-----------VMTAGRHGVARE--I-TA-GV----------LEGKYYPNH-------EAIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AEPNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEYGGFTNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQANYQE-------DFA-----PFTN--SG--IVYKE-GDDRE------------AIMYQ-----------AAH---YELVASARAV---KIG---HAIN---P---NL-NIGCMVAMCPIYPATC-N-PKDILMAQKAMQ--K-RY-YFADVHV--HGFYPEHIFKYWER--------K--------AIKVDFTERDKKD-LFEGTVDYIGFSYYMSFVI-----DAHRENNPYYDYL-ETEDLVK----------------------NPYVKASDWDWQ-IDPQGLRYALNWFTDMY-H-L-P-LF-IVQNGFG--AIDQ---VE-A--D--GMVH-----DDYRI----DYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDEG-KGTLKRSPKLSFNWYKEVIASNGDDI
26 PsiBlast_CBE 92.7038% -74 - C2 -2XHY BGLA_ECOLI B:[4-479] -----KKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREIT--------KEVL-PG-KY----------YPNH--E----------AVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDE--AQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE-------INNQRNWRAPLF-----GYCC--SG--VVYTE-HENPE------------ETMYQ-----------VLH---HQFVASALAV---KAA---RRIN---P---EM-KVGCMLAMVPLYPYSC-N-PDDVMFAQESMR--E-RY-VFTDVQL--RGYYPSYVLNEWER--------R--------GFNIKMEDGDLDV-LREGTCDYLGFSYYMTNAVK-------------------AEGG----------EG--------S-VPNPYVKASDWGWQ-IDPVGLRYALCELYERY-Q-R-P-LF-IVENGFG--AYDK---VE-E--D--GSIN-----DDYRI----DYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDG-TGDMSRSRKKSFNWYKEVIASNGEKL
5 PsiBlast_PDB 92.6640% -75 - C2 -4GPN ? A:[5-480] -------SKLPENFLWGGAVAAHQLEGGWQEGGKGISVAD-----------VMTAGRHGVARE--I-TA-GV----------LEGKYYPNH-------EAIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AEPNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEYGGFTNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQANYQE-------DFA-----PFTN--SG--IVYKE-GDDRE------------AIMYQ-----------AAH---YELVASARAV---KIG---HAIN---P---NL-NIGCMVAMCPIYPATC-N-PKDILMAQKAMQ--K-RY-YFADVHV--HGFYPEHIFKYWER--------K--------AIKVDFTERDKKD-LFEGTVDYIGFSYYMSFVI-----DAHRENNPYYDYL-ETEDLVK----------------------NPYVKASDWDWQ-IDPQGLRYALNWFTDMY-H-L-P-LF-IVQNGFG--AIDQ---VE-A--D--GMVH-----DDYRI----DYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDEG-KGTLKRSPKLSFNWYKEVIASNGDDI
24 PsiBlast_CBE 92.2638% -75 - C2 -2XHY BGLA_ECOLI D:[5-479] ------KLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREIT--------KEVL-PG-KY----------YPNH--E----------AVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDE--AQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE-------INNQRNWRAPLF-----GYCC--SG--VVYTE-HENPE------------ETMYQ-----------VLH---HQFVASALAV---KAA---RRIN---P---EM-KVGCMLAMVPLYPYSC-N-PDDVMFAQESMR--E-RY-VFTDVQL--RGYYPSYVLNEWER--------R--------GFNIKMEDGDLDV-LREGTCDYLGFSYYMTNAVK-------------------AEG---------------------S-VPNPYVKASDWGWQ-IDPVGLRYALCELYERY-Q-R-P-LF-IVENGFG--AYDK---VE-E--D--GSIN-----DDYRI----DYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDG-TGDMSRSRKKSFNWYKEVIASNGEKL
27 PsiBlast_CBE 92.2540% -73 - C2 -4F66 ? B:[5-480] -------SKLPENFLWGGAVAAHQLEGGWQEGGKGISVAD-----------VMTAGRHGVARE--I-TA-GV----------LEGKYYPNH-------EAIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AEPNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEYGGFTNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQANYQE-------DFA-----PFTN--SG--IVYKE-GDDRE------------AIMYQ-----------AAH---YELVASARAV---KIG---HAIN---P---NL-NIGCMVAMCPIYPATC-N-PKDILMAQKAMQ--K-RY-YFADVHV--HGFYPEHIFKYWER--------K--------AIKVDFTERDKKD-LFEGTVDYIGFSYYMSFVI-----DAHRENNPYYDYL-ETEDLVK----------------------NPYVKASDWDWQ-IDPQGLRYALNWFTDMY-H-L-P-LF-IVENGFG--AIDQ---VE-A--D--GMVH-----DDYRI----DYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDEG-KGTLKRSPKLSFNWYKEVIASNGDDI
2 PsiBlast_PDB 92.1838% -74 - C2 -2XHY BGLA_ECOLI A:[4-479] -----KKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREIT--------KEVL-PG-KY----------YPNH--E----------AVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDE--AQPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE-------INNQRNWRAPLF-----GYCC--SG--VVYTE-HENPE------------ETMYQ-----------VLH---HQFVASALAV---KAA---RRIN---P---EM-KVGCMLAMVPLYPYSC-N-PDDVMFAQESMR--E-RY-VFTDVQL--RGYYPSYVLNEWER--------R--------GFNIKMEDGDLDV-LREGTCDYLGFSYYMTNAVK-------------------AEGGT-------F-EG--------S-VPNPYVKASDWGWQ-IDPVGLRYALCELYERY-Q-R-P-LF-IVENGFG--AYDK---VE-E--D--GSIN-----DDYRI----DYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDG-TGDMSRSRKKSFNWYKEVIASNGEKL
3 PsiBlast_PDB 92.1440% -74 - C2 -4F66 ? A:[5-480] -------SKLPENFLWGGAVAAHQLEGGWQEGGKGISVAD-----------VMTAGRHGVARE--I-TA-GV----------LEGKYYPNH-------EAIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AEPNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEYGGFTNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQANYQE-------DFA-----PFTN--SG--IVYKE-GDDRE------------AIMYQ-----------AAH---YELVASARAV---KIG---HAIN---P---NL-NIGCMVAMCPIYPATC-N-PKDILMAQKAMQ--K-RY-YFADVHV--HGFYPEHIFKYWER--------K--------AIKVDFTERDKKD-LFEGTVDYIGFSYYMSFVI-----DAHRENNPYYDYL-ETEDLVK----------------------NPYVKASDWDWQ-IDPQGLRYALNWFTDMY-H-L-P-LF-IVENGFG--AIDQ---VE-A--D--GMVH-----DDYRI----DYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDEG-KGTLKRSPKLSFNWYKEVIASNGDDI
6 PsiBlast_PDB 92.0440% -74 - C2 -3PN8 ? A:[5-480] -------SKLPENFLWGGAVAAHQLEGGWQEGGKGISVAD-----------VMTAGRHGVARE--I-TA-GV----------LEGKYYPNH-------EAIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AEPNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEYGGFTNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQANYQE-------DFA-----PFTN--SG--IVYKE-GDDRE------------AIMYQ-----------AAH---YELVASARAV---KIG---HAIN---P---NL-NIGCMVAMCPIYPATC-N-PKDILMAQKAMQ--K-RY-YFADVHV--HGFYPEHIFKYWER--------K--------AIKVDFTERDKKD-LFEGTVDYIGFSYYMSFVI-----DAHRENNPYYDYL-ETEDLVK----------------------NPYVKASDWDWQ-IDPQGLRYALNWFTDMY-H-L-P-LF-IVENGFG--AIDQ---VE-A--D--GMVH-----DDYRI----DYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDEG-KGTLKRSPKLSFNWYKEVIASNGDDI
118 HHSearch 91.4540% -78 * C2 *2J78 BGLA_THEMA A:[25-467] ------VKKFPEGFLWGVATASYQIEGSPLADGAGMSIWH-----------TFS--------H--T-PG-NV----------KNGD--TGD-------VACDHYNRWKEDIEIIEKLGVKAYRFSISWPRILPEG-T--GRVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQL-KGGWANREIADWFAEYSRVLFENFGDRVKNWITLNE-------PW-------VVA-----IVGH--LY--GVHAP-GMRDI------------YVAFR-----------AVH---NLLRAHARAV---KVF---RETV---K---DG-KIGIVFNNGYFEPASE-K-EEDIRAVRFMHQ-FNNYP-LFLNPIY--RGDYPELVLEFAR------------------EYLPENYKDDMSE-IQEK-IDFVGLNYYSGHLVKFDPDA-AK--------------------VS---------------FVERDLPKTAMGWE-IVPEGIYWILKKVKEEY-NPP-E-VY-ITENGAA--FDDV---V--SE-D--GRVH-----DQNRI----DYLKAHIGQAWKAI-Q-EGVPLKGYFVWSLLDNFEWAEG-YSKRFGIVYVDYST------QKRIVKDSGYWYSNVVKNNGLE-