@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0300: (2016-03-14 )
MNNNFLWGGATASYQCEGAWDVDGKAESMWDYYLHEAGLENGDVASDHYHRYEEDIRMMKEGGQNSYRFSLSWPRIIKNRQGDINLKGIEFYQNLLDTCKKYDIEPFVTLYHWDLPQYWEETGGWLDHDVCAAFEHYAKVCYDHFGDKITNWTTFNEPKWFVANGYKIGNYPPGYQDTQKTMIAAYNVMYASALGVKAFKEGGYPGQIGIVHSYTPVNGIDESIETKIAMRYADNYCNNWILDTAALGEFPVDLIAELAKSHDISFMKTDELQTIKQNTVDFIGLNYYSRTLVKPYTGGETQLQFNHSGKKGESKVLIKNWFEQVKDPANETTEWDTEIYPKGLQDGLIEAYERYQLPLYVTENGIGVREDVSVPQVDDAYRIAFMNDHINAIFNAIDAGCDVRGYYAWSPFDLYSWKNGVEKRYGLVAVDFENNQIRKPKASYYWFKEMIESQGKLIKRREF

Atome Classification :

(70 SA) ---.........10........20........30.....-----.----.----.----40------...---......50........60........70.....------..--.80.--.......90........100.......110.......120..-.......130.......140.......150.......160.-......170...------------.-..-.180.......190.......200-.---.---.-.---.--.-...210..------......220-.......230.....-..240.......250...------..-----..260-------........270...--....280.......290..--.....300.......310.-......320.......330---......-----.-.340.......350--....-.--.-.-.360.....-..370-...-----.---...380.......390.....-..400.......410.......420.......430..-.....440.......450.......460.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---MNNNFLWGGATASYQCEGAWDVDGKAESMWDYYLHE-----A----G----L----E-------NGD---VASDHYHRYEEDIRMMKEGGQNSYRFSLSWPRI------IK--NRQG--DINLKGIEFYQNLLDTCKKYDIEPFVTLYHWDLPQYWE--ET-GGWLDHDVCAAFEHYAKVCYDHFGDKITNWTTFNEPKWFVA-NGYKIGNYPPGY------------Q-DT-QKTMIAAYNVMYASALGVKAFK---E---G---G-Y---P--G-QIGI-VHS------YTPVNGIDE-SIETKIAMRYADNYC-NNWILDTAALGEFPVDLI------AE-----LAK-S-------HDISFMKTDELQTI--KQNTVDFIGLNYYSRTLVK--PYTGGETQLQFNHSGKKGE-SKVLIKNWFEQVKDPANE----TTEWDT-----E-IYPKGLQDGLIEA---YERY-Q--L-P-LYVTENGIG-VREDV-SVP-----Q---VDDAYRIAFMNDHINAIFNAI-DAGCDVRGYYAWSPFDLYSWKNGVEKRYGLVAVDFEN-NQIRKPKASYYWFKEMIESQGKLIKRREF
121 Fugue 95.4638% -71 - C3 -1GNX ? A:[15-477] ALTFPEGFLWGSATASYQIEGAAAEDGRTPSIWDTYAR------T----P----------GRVRNGDTGD---VATDHYHRWREDVALMAELGLGAYRFSLAWPRIQPTGRG----------PALQKGLDFYRRLADELLAKGIQPVATLYHWDLPQELENA---GGWPERATAERFAEYAAIAADALGDRVKTWTTLNEPWCSAF-LGYGSGVHAPGRT-------------DP-VAALRAAHHLNLGHGLAVQALR---DRLP------A---D--A-QCSV-TLN------IHHVRPLTD-SDADADAVRRIDALA-NRVFTGPMLQGAYPEDLV------KD-----TAG-L-------TDWSFVRDGDLRLA--H-QKLDFLGVNYYSPTLVS--A-H----------SPWPGA-DRVAFHQ------PPGET----TAMG-W-----A-VDPSGLYELLRRL---SSDFPA--L-P-LVITENGAA-FHDY-----ADPEGN---VNDPERIAYVRDHLAAVHRAI-KDGSDVRGYFLWSLLDNFEWAHGYSKRFGAVYVDYPT--GTRIPKASARWYAEVARTGVLP------
18 PsiBlast_PDB 95.0737% -68 - C3 -1GNX ? A:[21-473] ------GFLWGSATASYQIEGAAAEDGRTPSIWDTYART-----P----G----RVRNGD-------TGD---VATDHYHRWREDVALMAELGLGAYRFSLAWPRI------QP--TGRG--PALQKGLDFYRRLADELLAKGIQPVATLYHWDLPQELE--NA-GGWPERATAERFAEYAAIAADALGDRVKTWTTLNEPWCSAF-LGYGSGVHAPGR------------T-DP-VAALRAAHHLNLGHGLAVQALR---D-------R-L---PADA-QCSV-TLN------IHHVRPLTD-SDADADAVRRIDALA-NRVFTGPMLQGAYPEDLV------KD-----TAG-L-------TDWSFVRDGDLRLA--HQK-LDFLGVNYYSPTLV-------------SAHSPWPGA-DRVA----FHQ---PPGE----TTAMGW-----A-VDPSGLYELLRRL---SSDFPA--L-P-LVITENGAA-F-HDY-ADP-----EGN-VNDPERIAYVRDHLAAVHRAI-KDGSDVRGYFLWSLLDNFEWAHGYSKRFGAVYVDYPT-G-TRIPKASARWYAEVART----------
41 PsiBlast_CBE 94.5037% -67 - C3 -1GNX ? B:[21-473] ------GFLWGSATASYQIEGAAAEDGRTPSIWDTYART-----P----G----RVRNGD-------TGD---VATDHYHRWREDVALMAELGLGAYRFSLAWPRI------QP--TGRG--PALQKGLDFYRRLADELLAKGIQPVATLYHWDLPQELE--NA-GGWPERATAERFAEYAAIAADALGDRVKTWTTLNEPWCSAF-LGYGSGVHAPGR------------T-DP-VAALRAAHHLNLGHGLAVQALR---D-------R-L---PADA-QCSV-TLN------IHHVRPLTD-SDADADAVRRIDALA-NRVFTGPMLQGAYPEDLV------KD-----TAG-L-------TDWSFVRDGDLRLA--HQK-LDFLGVNYYSPTLVS--------------HSPWPGA-DRVA----FHQ---PPGE----TTAMGW-----A-VDPSGLYELLRRL---SSDFPA--L-P-LVITENGAA-F-HDY-ADP-----EGN-VNDPERIAYVRDHLAAVHRAI-KDGSDVRGYFLWSLLDNFEWAHGYSKRFGAVYVDYPT-G-TRIPKASARWYAEVART----------
19 PsiBlast_PDB 94.4037% -69 - C3 -1GON ? A:[21-473] ------GFLWGSATASYQIEGAAAEDGRTPSIWDTYART-----P----G----RVRNGD-------TGD---VATDHYHRWREDVALMAELGLGAYRFSLAWPRI------QP--TGRG--PALQKGLDFYRRLADELLAKGIQPVATLYHWDLPQELE--NA-GGWPERATAERFAEYAAIAADALGDRVKTWTTLNEPWCSAF-LGYGSGVHAPGR------------T-DP-VAALRAAHHLNLGHGLAVQALR---D-------R-L---PADA-QCSV-TLN------IHHVRPLTD-SDADADAVRRIDALA-NRVFTGPMLQGAYPEDLV------KD-----TAG-L-------TDWSFVRDGDLRLA--HQK-LDFLGVNYYSPTLV-------------SAHSPWPGA-DRVA----FHQ---PPGE----TTAMGW-----A-VDPSGLYELLRRL---SSDFPA--L-P-LVITENGAA-F-HDY-ADP-----EGN-VNDPERIAYVRDHLAAVHRAI-KDGSDVRGYFLWSLLDNFEWAHGYSKRFGAVYVDYPT-G-TRIPKASARWYAEVART----------
8 PsiBlast_PDB 93.6236% -64 - C3 -4PBG LACG_LACLL A:[5-465] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLED-----N----Y----W----Y-------TAE---PASDFYHKYPVDLELAEEYGVNGIRISIAWSRI------FP--TGYG--EVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALH--SN-GDFLNRENIEHFIDYAAFCFEEFPE-VNYWTTFNEIGPIGD-GQYLVGKFPPGI------------KYDL-AKVFQSHHNMMVSHARAVKLYK---D---K---G-Y---K--G-EIGV-VHALPTKYPYDPENPADV-R-----AAELEDIIH-NKFILDATYLGHYS-DKT------MEGVNHILAE-N-------GGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQ--AFD-GETEIIHNGKGEKGS-SKYQIKGVGRRVAPDYVP----RTDWDW-----I-IYPEGLYDQIMRVKNDYPNY-K----K-IYITCNGLG-YKDEF-VDN-----T---VYDDGRIDYVKQHLEVLSDAI-ADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDF-D-TQERYPKKSAHWYKKLAETQ---------
30 PsiBlast_CBE 93.4936% -65 - C3 -4PBG LACG_LACLL B:[5-465] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLED-----N----Y----W----Y-------TAE---PASDFYHKYPVDLELAEEYGVNGIRISIAWSRI------FP--TGYG--EVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALH--SN-GDFLNRENIEHFIDYAAFCFEEFPE-VNYWTTFNEIGPIGD-GQYLVGKFPPGI------------KYDL-AKVFQSHHNMMVSHARAVKLYK---D---K---G-Y---K--G-EIGV-VHALPTKYPYDPENPADV-R-----AAELEDIIH-NKFILDATYLGHYS-DKT------MEGVNHILAE-N-------GGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQ--AFD-GETEIIHNGKGEKGS-SKYQIKGVGRRVAPDYVP----RTDWDW-----I-IYPEGLYDQIMRVKNDYPNY-K----K-IYITCNGLG-YKDEF-VDN-----T---VYDDGRIDYVKQHLEVLSDAI-ADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDF-D-TQERYPKKSAHWYKKLAETQ---------
28 PsiBlast_CBE 93.2136% -63 - C3 -3PBG LACG_LACLL B:[5-465] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLED-----N----Y----W----Y-------TAE---PASDFYHKYPVDLELAEEYGVNGIRISIAWSRI------FP--TGYG--EVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALH--SN-GDFLNRENIEHFIDYAAFCFEEFPE-VNYWTTFNEIGPIGD-GQYLVGKFPPGI------------KYDL-AKVFQSHHNMMVSHARAVKLYK---D---K---G-Y---K--G-EIGV-VHALPTKYPYDPENPADV-R-----AAELEDIIH-NKFILDATYLGHYS-DKT------MEGVNHILAE-N-------GGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQ--AFD-GETEIIHNGKGEKGS-SKYQIKGVGRRVAPDYVP----RTDWDW-----I-IYPEGLYDQIMRVKNDYPNY-K----K-IYITENGLG-YKDEF-VDN-----T---VYDDGRIDYVKQHLEVLSDAI-ADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDF-D-TQERYPKKSAHWYKKLAETQ---------
24 PsiBlast_CBE 93.2138% -72 - C3 -4PTV ? B:[10-445] ------DFIWGAATSSYQIEGAFNEDGKGESIWDRFSHT-----P----GK---I----E-------NGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRI------LP--EGKG--RVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQ--DK-GGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEP-WVVAFEGHAFGNHAPGT------------K-DF-KTALQVAHHLLLSHGMAVDIFR---E---E---D-L---P--G-EIGI-TLN------LTPAYPAGD-SEKDVKAASLLDDYI-NAWFLSPVFKGSYPEELH------HI-----YEQ-N-------LGAFTTQPGDMDII--SRD-IDFLGINYYSRMVVR--HKPGDNL---FNA----------------EVVKMEDRP----STEMGW-----E-IYPQGLYDILVRV---NKEYTD--K-P-LYITENGAA-FDDKL-TEEG----K---IHDEKRINYLGDHFKQAYKAL-KDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYEN-GNRRFLKDSALWYREVIE-----------
7 PsiBlast_PDB 92.9136% -64 - C3 -3PBG LACG_LACLL A:[5-465] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLED-----N----Y----W----Y-------TAE---PASDFYHKYPVDLELAEEYGVNGIRISIAWSRI------FP--TGYG--EVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALH--SN-GDFLNRENIEHFIDYAAFCFEEFPE-VNYWTTFNEIGPIGD-GQYLVGKFPPGI------------KYDL-AKVFQSHHNMMVSHARAVKLYK---D---K---G-Y---K--G-EIGV-VHALPTKYPYDPENPADV-R-----AAELEDIIH-NKFILDATYLGHYS-DKT------MEGVNHILAE-N-------GGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQ--AFD-GETEIIHNGKGEKGS-SKYQIKGVGRRVAPDYVP----RTDWDW-----I-IYPEGLYDQIMRVKNDYPNY-K----K-IYITENGLG-YKDEF-VDN-----T---VYDDGRIDYVKQHLEVLSDAI-ADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDF-D-TQERYPKKSAHWYKKLAETQ---------
6 PsiBlast_PDB 92.7036% -65 - C3 -2PBG LACG_LACLL A:[5-465] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLED-----N----Y----W----Y-------TAE---PASDFYHKYPVDLELAEEYGVNGIRISIAWSRI------FP--TGYG--EVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALH--SN-GDFLNRENIEHFIDYAAFCFEEFPE-VNYWTTFNEIGPIGD-GQYLVGKFPPGI------------KYDL-AKVFQSHHNMMVSHARAVKLYK---D---K---G-Y---K--G-EIGV-VHALPTKYPYDPENPADV-R-----AAELEDIIH-NKFILDATYLGHY-CDKT------MEGVNHILAE-N-------GGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQ--AFD-GETEIIHNGKGEKGS-SKYQIKGVGRRVAPDYVP----RTDWDW-----I-IYPEGLYDQIMRVKNDYPNY-K----K-IYITENGLG-YKDEF-VDN-----T---VYDDGRIDYVKQHLEVLSDAI-ADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDF-D-TQERYPKKSAHWYKKLAETQ---------
22 PsiBlast_CBE 92.6938% -70 - C3 -4PTX ? B:[10-445] ------DFIWGAATSSYQIEGAFNEDGKGESIWDRFSHT-----P----GK---I----E-------NGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRI------LP--EGKG--RVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQ--DK-GGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEP-WVVAFEGHAFGNHAPGT------------K-DF-KTALQVAHHLLLSHGMAVDIFR---E---E---D-L---P--G-EIGI-TLN------LTPAYPAGD-SEKDVKAASLLDDYI-NAWFLSPVFKGSYPEELH------HI-----YEQ-N-------LGAFTTQPGDMDII--SRD-IDFLGINYYSRMVVR--HKPGDNL---FNA----------------EVVKMEDRP----STEMGW-----E-IYPQGLYDILVRV---NKEYTD--K-P-LYITENGAA-FDDKL-TEEG----K---IHDEKRINYLGDHFKQAYKAL-KDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYEN-GNRRFLKDSALWYREVIE-----------
4 PsiBlast_PDB 92.6638% -72 - C3 -4PTX ? A:[10-445] ------DFIWGAATSSYQIEGAFNEDGKGESIWDRFSHT-----P----GK---I----E-------NGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRI------LP--EGKG--RVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQ--DK-GGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEP-WVVAFEGHAFGNHAPGT------------K-DF-KTALQVAHHLLLSHGMAVDIFR---E---E---D-L---P--G-EIGI-TLN------LTPAYPAGD-SEKDVKAASLLDDYI-NAWFLSPVFKGSYPEELH------HI-----YEQ-N-------LGAFTTQPGDMDII--SRD-IDFLGINYYSRMVVR--HKPGDNL---FNA----------------EVVKMEDRP----STEMGW-----E-IYPQGLYDILVRV---NKEYTD--K-P-LYITENGAA-FDDKL-TEEG----K---IHDEKRINYLGDHFKQAYKAL-KDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYEN-GNRRFLKDSALWYREVIE-----------
85 PsiBlast_CBE 92.6136% -75 - C3 -1OIN BGLA_THEMA B:[32-465] -------FLWGVATASYQIEGSPLADGAGMSIWHTFSHT-----P----GNVKNG----D-------TGD---VACDHYNRWKEDIEIIEKLGVKAYRFSISWPRI------LP--EGTG--RVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQ--LK-GGWANREIADWFAEYSRVLFENFGDRVKNWITLNEP-WVVAIVGHLYGVHAPGM------------R-DI-YVAFRAVHNLLRAHARAVKVFR---E---T---V-----D--G-KIGI-VFNNGY---FEPASEKEE-DIRAVRFMHQFNNYP---LFLNPIYRGDYP-ELV------LE-----FAR-E-------YLPENYKDDMSEI----QEKIDFVGLNYYSGHLVK--FDPDAPAKVSFVE-------------------RDLPKT----AMGW-------E-IVPEGIYWILKKV---KEEY-N--P-PEVYITENGAA-FDDVV-SEDG----R---VHDQNRIDYLKAHIGQAWKAI-QEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYVDY-S-TQKRIVKDSGYWYSNVVKNNG--------
12 PsiBlast_PDB 92.5135% -72 - C3 -4HZ8 ? A:[9-441] -------FLWGAATSSYQIEGAWNEDGKGESIWDRFTRI-----P----G----KIKNGD-------SGD---VACDHYHRYEQDLDLMRQLGLKTYRFSIAWARI------QP--DSSR--QINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVE--DE-GGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVW-AGYHMGLFAPGL------------K-DP-TLGGRVAHHLLLSHGQALQAFR---A---L---S-P---A--GSQMGI-TLN------FNTIYPVSA-EPADVEAARRMHSFQ-NELFLEPLIRGQY--NQA------TL-----MAY-P-------NLPEFIAPEDMQTI--SA-PIDFLGVNYYNPMRVKSSPQPPGIEVVQV-------E-SPVTAMGW-------------------------E-IAPEGLYDLLMGI---TRTYGK--L-P-IYITENGAA-FDDQP-DQSG----Q---VNDPQRVGYFQGHIGAARRAL-ADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFET-QQ-RTLKQSAQWYRDVIANNG--------
29 PsiBlast_CBE 92.4636% -69 - C3 -1PBG LACG_LACLL B:[5-465] ---LPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLED-----N----Y----W----Y-------TAE---PASDFYHKYPVDLELAEEYGVNGIRISIAWSRI------FP--TGYG--EVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALH--SN-GDFLNRENIEHFIDYAAFCFEEFPE-VNYWTTFNEIGPIGD-GQYLVGKFPPGI------------KYDL-AKVFQSHHNMMVSHARAVKLYK---D---K---G-Y---K--G-EIGV-VHALPTKYPYDPENPADV-R-----AAELEDIIH-NKFILDATYLGHYS-DKT------MEGVNHILAE-N-------GGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQ--AFD-GETEIIH---------SKYQIKGVGRRVAPDYVP----R----W-----I-IYPEGLYDQIMRVKNDYPNY-K----K-IYITENGLG-YKDEF-VDN-----T---VYDDGRIDYVKQHLEVLSDAI-ADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDF-D-TQERYPKKSAHWYKKLAETQ---------
27 PsiBlast_CBE 92.4538% -65 - C3 -3AHX ? B:[9-444] ------DFIFGTATAAYQIEGAYKEDEKGESIWDRFSHI-----P----GNVAKM----H-------NGD---IACDHYHRYKEDVQLLKSLGIKSYRFSIAWPRI------FP--KGFG--EINQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKLQ--DI-GGWANPQVADYYVDYANLLFREFGDRVKTWITHNEPWVASY-LGYALGVHAPGI------------K-DM-KMALLAAHNILLSHFKAVKAYR---E---L---E-Q---D--G-QIGI-TLN------LSTCYSNSA-DEEDIAAAHRSDGWN-NRWFLDAALKGTYPEDMI------KI-----FSD-T-------NIMPELPK-ELFTE--VFETSDFLGINYYTRQVVK--N----------NSEAFIGA-ESVAMD----------NP----KTEMGW-----E-IYPQGLYDLLTRI---HRDYGN--I-D-LYITENGAA-FNDMV-NRDG----K---VEDENRLDYLYTHFAAALSAI-EAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHVNYK--TQERTIKKSAYWYKELIERSN--------
2 PsiBlast_PDB 92.3738% -72 - C3 -4PTV ? A:[10-445] ------DFIWGAATSSYQIEGAFNEDGKGESIWDRFSHT-----P----GK---I----E-------NGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRI------LP--EGKG--RVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQ--DK-GGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEP-WVVAFEGHAFGNHAPGT------------K-DF-KTALQVAHHLLLSHGMAVDIFR---E---E---D-L---P--G-EIGI-TLN------LTPAYPAGD-SEKDVKAASLLDDYI-NAWFLSPVFKGSYPEELH------HI-----YEQ-N-------LGAFTTQPGDMDII--SRD-IDFLGINYYSRMVVR--HKPGDNL---FNA----------------EVVKMEDRP----STEMGW-----E-IYPQGLYDILVRV---NKEYTD--K-P-LYITENGAA-FDDKL-TEEG----K---IHDEKRINYLGDHFKQAYKAL-KDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYEN-GNRRFLKDSALWYREVIE-----------
68 PsiBlast_CBE 92.3136% -74 - C3 -2J79 BGLA_THEMA A:[32-465] -------FLWGVATASYQIEGSPLADGAGMSIWHTFSHT-----P----GNVKNG----D-------TGD---VACDHYNRWKEDIEIIEKLGVKAYRFSISWPRI------LP--EGTG--RVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQ--LK-GGWANREIADWFAEYSRVLFENFGDRVKNWITLNEP-WVVAIVGHLYGVHAPGM------------R-DI-YVAFRAVHNLLRAHARAVKVFR---E---T---V-K---D--G-KIGI-VFNNGY---FEPAS---E-DIRAVRFMHQFNNYP---LFLNPIYRGDYP-ELV------LE-----FAR-E-------YLPENYKDDMSEI----QEKIDFVGLNYYSGHLVK--FDP---AKVSFVE-------------------RDLPKT----AMGW-------E-IVPEGIYWILKKV---KEEY-N--P-PEVYITENGAA-FDDVV-SEDG----R---VHDQNRIDYLKAHIGQAWKAI-QEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYVDY-S-TQKRIVKDSGYWYSNVVKNNG--------
11 PsiBlast_PDB 92.2735% -74 - C3 -4HZ7 ? A:[9-441] -------FLWGAATSSYQIEGAWNEDGKGESIWDRFTRI-----P----G----KIKNGD-------SGD---VACDHYHRYEQDLDLMRQLGLKTYRFSIAWARI------QP--DSSR--QINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVE--DE-GGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVW-AGYHMGLFAPGL------------K-DP-TLGGRVAHHLLLSHGQALQAFR---A---L---S-P---A--GSQMGI-TLN------FNTIYPVSA-EPADVEAARRMHSFQ-NELFLEPLIRGQY--NQA------TL-----MAY-P-------NLPEFIAPEDMQTI--SA-PIDFLGVNYYNPMRVKSSPQPPGIEVVQV-------E-SPVTAMGW-------------------------E-IAPEGLYDLLMGI---TRTYGK--L-P-IYITENGAA-FDDQP-DQSG----Q---VNDPQRVGYFQGHIGAARRAL-ADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFET-QQ-RTLKQSAQWYRDVIANNG--------
26 PsiBlast_CBE 92.2538% -63 - C3 -3AHX ? C:[9-444] ------DFIFGTATAAYQIEGAYKEDEKGESIWDRFSHI-----P----GNVAKM----H-------NGD---IACDHYHRYKEDVQLLKSLGIKSYRFSIAWPRI------FP--KGFG--EINQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKLQ--DI-GGWANPQVADYYVDYANLLFREFGDRVKTWITHNEPWVASY-LGYALGVHAPGI------------K-DM-KMALLAAHNILLSHFKAVKAYR---E---L---E-Q---D--G-QIGI-TLN------LSTCYSNSA-DEEDIAAAHRSDGWN-NRWFLDAALKGTYPEDMI------KI-----FSD-T-------NIMPELPK-ELFTE--VFETSDFLGINYYTRQVVK--N----------NSEAFIGA-ESVAMD----------NP----KTEMGW-----E-IYPQGLYDLLTRI---HRDYGN--I-D-LYITENGAA-FNDMV-NRDG----K---VEDENRLDYLYTHFAAALSAI-EAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHVNYK--TQERTIKKSAYWYKELIERSN--------
23 PsiBlast_CBE 92.1438% -70 - C3 -4PTW ? B:[10-445] ------DFIWGAATSSYQIEGAFNEDGKGESIWDRFSHT-----P----GK---I----E-------NGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRI------LP--EGKG--RVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQ--DK-GGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEP-WVVAFEGHAFGNHAPGT------------K-DF-KTALQVAHHLLLSHGMAVDIFR---E---E---D-L---P--G-EIGI-TLN------LTPAYPAGD-SEKDVKAASLLDDYI-NAWFLSPVFKGSYPEELH------HI-----YEQ-N-------LGAFTTQPGDMDII--SRD-IDFLGINYYSRMVVR--HKPGDNL---FNA----------------EVVKMEDRP----STEMGW-----E-IYPQGLYDILVRV---NKEYTD--K-P-LYITENGAA-FDDKL-TEEG----K---IHDEKRINYLGDHFKQAYKAL-KDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYEN-GNRRFLKDSALWYREVIE-----------
3 PsiBlast_PDB 92.0938% -71 - C3 -4PTW ? A:[10-445] ------DFIWGAATSSYQIEGAFNEDGKGESIWDRFSHT-----P----GK---I----E-------NGDTGDIACDHYHLYREDIELMKEIGIRSYRFSTSWPRI------LP--EGKG--RVNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQALQ--DK-GGWTNRDTAKYFAEYARLMFEEFNGLVDLWVTHNEP-WVVAFEGHAFGNHAPGT------------K-DF-KTALQVAHHLLLSHGMAVDIFR---E---E---D-L---P--G-EIGI-TLN------LTPAYPAGD-SEKDVKAASLLDDYI-NAWFLSPVFKGSYPEELH------HI-----YEQ-N-------LGAFTTQPGDMDII--SRD-IDFLGINYYSRMVVR--HKPGDNL---FNA----------------EVVKMEDRP----STEMGW-----E-IYPQGLYDILVRV---NKEYTD--K-P-LYITENGAA-FDDKL-TEEG----K---IHDEKRINYLGDHFKQAYKAL-KDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYEN-GNRRFLKDSALWYREVIE-----------
61 PsiBlast_CBE 92.0536% -74 - C3 -2J7G BGLA_THEMA B:[32-465] -------FLWGVATASYQIEGSPLADGAGMSIWHTFSHT-----P----GNVKNG----D-------TGD---VACDHYNRWKEDIEIIEKLGVKAYRFSISWPRI------LP--EGTG--RVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQ--LK-GGWANREIADWFAEYSRVLFENFGDRVKNWITLNEP-WVVAIVGHLYGVHAPGM------------R-DI-YVAFRAVHNLLRAHARAVKVFR---E---T---V-K---D--G-KIGI-VFNNGY---FEPASEKEE-DIRAVRFMHQFNNYP---LFLNPIYRGDYP-ELV------LE-----FAR-E-------YLPENYKDDMSEI----QEKIDFVGLNYYSGHLVK--FDPDA-AKVSFVE-------------------RDLPKT----AMGW-------E-IVPEGIYWILKKV---KEEY-N--P-PEVYITENGAA-FDDVV-SEDG----R---VHDQNRIDYLKAHIGQAWKAI-QEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYVDY-S-TQKRIVKDSGYWYSNVVKNNG--------
77 PsiBlast_CBE 91.9836% -73 - C3 -2CBV BGLA_THEMA B:[32-465] -------FLWGVATASYQIEGSPLADGAGMSIWHTFSHT-----P----GNVKNG----D-------TGD---VACDHYNRWKEDIEIIEKLGVKAYRFSISWPRI------LP--EGTG--RVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQ--LK-GGWANREIADWFAEYSRVLFENFGDRVKNWITLNEP-WVVAIVGHLYGVHAPGM------------R-DI-YVAFRAVHNLLRAHARAVKVFR---E---T---V-K---D--G-KIGI-VFNNGY---FEPASEKEE-DIRAVRFMHQFNNYP---LFLNPIYRGDYP-ELV------LE-----FAR-E-------YLPENYKDDMSEI----QEKIDFVGLNYYSGHLVK--FDPDAPAKVSFVE-------------------RDLPKT----AMGW-------E-IVPEGIYWILKKV---KEEY-N--P-PEVYITENGAA-FDDVV-SEDG----R---VHDQNRIDYLKAHIGQAWKAI-QEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYVDY-S-TQKRIVKDSGYWYSNVVKNNG--------
72 PsiBlast_CBE 91.8336% -73 - C3 -2J75 BGLA_THEMA B:[32-465] -------FLWGVATASYQIEGSPLADGAGMSIWHTFSHT-----P----GNVKNG----D-------TGD---VACDHYNRWKEDIEIIEKLGVKAYRFSISWPRI------LP--EGTG--RVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQ--LK-GGWANREIADWFAEYSRVLFENFGDRVKNWITLNEP-WVVAIVGHLYGVHAPGM------------R-DI-YVAFRAVHNLLRAHARAVKVFR---E---T---V-K---D--G-KIGI-VFNNGY---FEPASEKEE-DIRAVRFMHQFNNYP---LFLNPIYRGDYP-ELV------LE-----FAR-E-------YLPENYKDDMSEI----QEKIDFVGLNYYSGHLVK--FDPDAPAKVSFVE-------------------RDLPKT----AMGW-------E-IVPEGIYWILKKV---KEEY-N--P-PEVYITENGAA-FDDVV-SEDG----R---VHDQNRIDYLKAHIGQAWKAI-QEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYVDY-S-TQKRIVKDSGYWYSNVVKNNG--------
63 PsiBlast_CBE 91.6736% -72 - C3 -2J7E BGLA_THEMA B:[32-465] -------FLWGVATASYQIEGSPLADGAGMSIWHTFSHT-----P----GNVKNG----D-------TGD---VACDHYNRWKEDIEIIEKLGVKAYRFSISWPRI------LP--EGTG--RVNQKGLDFYNRIIDTLLEKGITPFVTIYHWDLPFALQ--LK-GGWANREIADWFAEYSRVLFENFGDRVKNWITLNEP-WVVAIVGHLYGVHAPGM------------R-DI-YVAFRAVHNLLRAHARAVKVFR---E---T---V-K---D--G-KIGI-VFNNGY---FEPASEKEE-DIRAVRFMHQFNNYP---LFLNPIYRGDYP-ELV------LE-----FAR-E-------YLPENYKDDMSEI----QEKIDFVGLNYYSGHLVK--FDPDA-AKVSFVE-------------------RDLPKT----AMGW-------E-IVPEGIYWILKKV---KEEY-N--P-PEVYITENGAA-FDDVV-SEDG----R---VHDQNRIDYLKAHIGQAWKAI-QEGVPLKGYFVWSLLDNFEWAEGYSKRFGIVYVDY-S-TQKRIVKDSGYWYSNVVKNNG--------
44 PsiBlast_CBE 91.6332% -73 - C3 -2O9T BGLB_PAEPO A:[17-453] ------TFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQI-----P----G----KVIGGD-------CGD---VACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRI------MP---AAG--IINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIE--DE-GGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASI-LGYGTGEHAPGH------------E-NW-REAFTAAHHILMCHGIASNLHK---E---K---G-L---T--G-KIGI-TLN------MEHVDAASE-RPEDVAAAIRRDGFI-NRWFAEPLFNGKYPEDMV------EW-----YGTYL-------NGLDFVQPGDMELI--QQPG-DFLGINYYTRSIIR--S-TNDASLLQVEQV----------------HMEEP-------VTDMGW-----E-IHPESFYKLLTRI---EKDF-SKGL-P-ILITENGAA-MRDEL-VNG-----Q---IEDTGRQRYIEEHLKACHRFI-EEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYE--TQERTPKQSALWFKQMMAKNG--------
9 PsiBlast_PDB 91.6135% -72 - C3 -3CMJ ? A:[30-462] -------FLWGAATSSYQIEGAWNEDGKGESIWDRFTRI-----P----G----KIKNGD-------SGD---VACDHYHRYEQDLDLMRQLGLKTYRFSIAWARI------QP--DSSR--QINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVE--DE-GGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVW-AGYHMGLFAPGL------------K-DP-TLGGRVAHHLLLSHGQALQAFR---A---L---S-P---A--GSQMGI-TLN------FNTIYPVSA-EPADVEAARRMHSFQ-NELFLEPLIRGQY--NQA------TL-----MAY-P-------NLPEFIAPEDMQTI--SA-PIDFLGVNYYNPMRVKSSPQPPGIEVVQV-------E-SPVTAMGW-------------------------E-IAPEGLYDLLMGI---TRTYGK--L-P-IYITENGAA-FDDQP-DQSG----Q---VNDPQRVGYFQGHIGAARRAL-ADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFET-QQ-RTLKQSAQWYRDVIANNG--------