@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0343: (2016-03-14 )
MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKEICSIVDGPVSAEVIGLEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKTNVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISASIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN

Atome Classification :

(50 SA) .........10-----........20........30....---------..--------------------.-----.40-------------------.----------------------.----..---------------------------------..----.--------..---------50........---.60--.........70......--.-------..-------80........90.......-.100.......110.......120..-----------------.....130...--------------.---------.--------------.----------.--140.......150..------------..-...160..--.....170.---......180-.......190.......200.......210......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKFFLDTASVS-----EIKRISELGLVDGVTTNPTIIAKE---------GR--------------------P-----FE--------------------E----------------------V----IK---------------------------------EI----C--------SI---------V-DGPVSAEV---IG---LEADKMVEEA-RILAKW--A-------PN-------VVVKIPMTEEGLKAVHTLT-AEGIKTNVTLIFTVSQGLMAAKAGAT-----------------YISPFLGRLDD--------------I---------G--------------T----------D--GMILIKNLKKVLDNY------------GL-KAEIISAS--IRHIGHLEE---AAEAGAHIA-TIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN
87 HHSearch 94.6858%-115 - C3 -3R8R TAL_BACSU A:[1-212] MLFFVDTANID-----EIREANELGILAGVTTNPSLVAKE---------ANV-------------------S-----FH--------------------D----------------------R----LR---------------------------------EI----T--------DV---------V-KGSVSAEV---IS---LKAEEMIEEG-KELAKI--A-------PN-------ITVKIPMTSDGLKAVRALT-DLGIKTNVTLIFNANQALLAARAGAT-----------------YVSPFLGRLDD--------------I---------G--------------H----------N--GLDLISEVKQIFDIH------------GL-DTQIIAAS--IRHPQHVTE---AALRGAHIG-TMPLKVIHALTKHPLTDKGIEQFLADWNK-------
56 PsiBlast_CBE 94.5458%-117 - C3 -3R8R TAL_BACSU B:[1-210] MLFFVDTANID-----EIREANELGILAGVTTNPSLVAKE---------ANV-------------------S-----FH--------------------D----------------------R----LR---------------------------------EI----T--------DV---------V-KGSVSAEV---IS---LKAEEMIEEG-KELAKI--A-------PN-------ITVKIPMTSDGLKAVRALT-DLGIKTNVTLIFNANQALLAARAGAT-----------------YVSPFLGRLDD--------------I---------G--------------H----------N--GLDLISEVKQIFDIH------------GL-DTQIIAAS--IRHPQHVTE---AALRGAHIG-TMPLKVIHALTKHPLTDKGIEQFLADW---------
54 PsiBlast_CBE 94.4058%-121 - C3 -3R8R TAL_BACSU D:[1-210] MLFFVDTANID-----EIREANELGILAGVTTNPSLVA---------------------------------S-----FH--------------------D----------------------R----LR---------------------------------EI----T--------DV---------V-KGSVSAEV---IS---LKAEEMIEEG-KELAKI--A-------PN-------ITVKIPMTSDGLKAVRALT-DLGIKTNVTLIFNANQALLAARAGAT-----------------YVSPFLGRLDD--------------I---------G--------------H----------N--GLDLISEVKQIFDIH------------GL-DTQIIAAS--IRHPQHVTE---AALRGAHIG-TMPLKVIHALTKHPLTDKGIEQFLADW---------
2 PsiBlast_PDB 94.3858%-115 - C3 -3R8R TAL_BACSU A:[1-210] MLFFVDTANID-----EIREANELGILAGVTTNPSLVAKE---------ANV-------------------S-----FH--------------------D----------------------R----LR---------------------------------EI----T--------DV---------V-KGSVSAEV---IS---LKAEEMIEEG-KELAKI--A-------PN-------ITVKIPMTSDGLKAVRALT-DLGIKTNVTLIFNANQALLAARAGAT-----------------YVSPFLGRLDD--------------I---------G--------------H----------N--GLDLISEVKQIFDIH------------GL-DTQIIAAS--IRHPQHVTE---AALRGAHIG-TMPLKVIHALTKHPLTDKGIEQFLADW---------
40 PsiBlast_CBE 93.7158%-115 - C3 -3R8R TAL_BACSU W:[1-210] MLFFVDTANID-----EIREANELGILAGVTTNPSLVAKE---------ANV-------------------S-----FH--------------------D----------------------R----LR---------------------------------EI----T--------DV---------V-KGSVSAEV---IS---LKAEEMIEEG-KELAKI--A-------PN-------ITVKIPMTSDGLKAVRALT-DLGIKTNVTLIFNANQALLAARAGAT-----------------YVSPFLGRLDD--------------I---------G--------------H----------N--GLDLISEVKQIFDIH------------GL-DTQIIAAS--IRHPQHVTE---AALRGAHIG-TMPLKVIHALTKHPLTDKGIEQFLADW---------
30 PsiBlast_CBE 93.5456%-117 - C3 -1VPX TAL_THEMA K:[13-224] MKIFLDTANLE-----EIKKGVEWGIVDGVTTNPTLISKE---------GA--------------------E-----FK--------------------Q----------------------R----VK---------------------------------EI----C--------DL---------V-KGPVSAEV---VS---LDYEGMVREA-RELAQI--S-------EY-------VVIKIPMTPDGIKAVKTLS-AEGIKTNVTLVFSPAQAILAAKAGAT-----------------YVSPFVGRMDD--------------L---------S--------------N----------D--GMRMLGEIVEIYNNY------------GF-ETEIIAAS--IRHPMHVVE---AALMGVDIV-TMPFAVLEKLFKHPMTDLGIERFMEDWKKY------
38 PsiBlast_CBE 92.6456%-115 - C3 -1VPX TAL_THEMA C:[13-219] MKIFLDTANLE-----EIKKGVEWGIVDGVTTNPTLISKE---------GA--------------------E-----FK--------------------Q----------------------R----VK---------------------------------EI----C--------DL---------V-KGPVSAEV---VS---LDYEGMVREA-RELAQI--S-------EY-------VVIKIPMTPDGIKAVKTLS-AEGIKTNVTLVFSPAQAILAAKAGAT-----------------YVSPFVGRMDD--------------L---------S--------------N----------D--GMRMLGEIVEIYNNY------------GF-ETEIIAAS--IRHPMHVVE---AALMGVDIV-TMPFAVLEKLFKHPMTDLGIERFME-----------
26 PsiBlast_CBE 92.3856%-118 - C3 -1VPX TAL_THEMA O:[13-220] MKIFLDTANLE-----EIKKGVEWGIVDGVTTNPTLISKE---------GA--------------------E-----FK--------------------Q----------------------R----VK---------------------------------EI----C--------DL---------V-KGPVSAEV---VS---LDYEGMVREA-RELAQI--S-------EY-------VVIKIPMTPDGIKAVKTLS-AEGIKTNVTLVFSPAQAILAAKAGAT-----------------YVSPFVGRMDD--------------L---------S--------------N----------D--GMRMLGEIVEIYNNY------------GF-ETEIIAAS--IRHPMHVVE---AALMGVDIV-TMPFAVLEKLFKHPMTDLGIERFMED----------
89 HHSearch 92.0753%-117 * C3 *1WX0 - TAL_THET8 A:[1-211] MELYLDTASLE-----EIREIAAWGVLSGVTTNPTLVAKA---------FAAKGE----------------ALTEEAFA--------------------A----------------------H----LR---------------------------------AI----C--------ET---------V-GGPVSAEV---TA---LEAEAMVAEG-RRLAAI--H-------PN-------IVVKLPTTEEGLKACKRLS-AEGIKVNMTLIFSANQALLAARAGAS-----------------YVSPFLGRVDD--------------I---------S--------------W----------D--GGELLREIVEMIQVQ------------DL-PVKVIAAS--IRHPRHVTE---AALLGADIA-TMPHAVFKQLLKHPLTDIGL----------------
7 PsiBlast_PDB 91.7651%-116 - C3 -1WX0 - TAL_THET8 A:[1-211] MELYLDTASLE-----EIREIAAWGVLSGVTTNPTLVAKAFAAKGEALTEE--------------------A-----FA--------------------A----------------------H----LR---------------------------------AI----C--------ET---------V-GGPVSAEV---TA---LEAEAMVAEG-RRLAAI--H-------PN-------IVVKLPTTEEGLKACKRLS-AEGIKVNMTLIFSANQALLAARAGAS-----------------YVSPFLGRVDD--------------I---------S--------------W----------D--GGELLREIVEMIQVQ------------DL-PVKVIAAS--IRHPRHVTE---AALLGADIA-TMPHAVFKQLLKHPLTDIGL----------------
66 PsiBlast_CBE 91.6250%-115 - C3 -3S1U TAL_THEAC D:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
86 HHSearch 90.6355%-122 - C3 -1VPX - TAL_THEMA A:[13-228] MKIFLDTANLE-----EIKKGVEWGIVDGVTTNP-----------------------------------------------------------------Q----------------------R----VK---------------------------------EI----C--------DL---------V-KGPVSAEV---VS---LDYEGMVREA-RELAQI--S-------EY-------VVIKIPMTPDGIKAVKTLS-AEGIKTNVTLVFSPAQAILAAKAGAT-----------------YVSPFVGRMDD--------------L---------S--------------N----------D--GMRMLGEIVEIYNNY------------GF-ETEIIAAS--IRHPMHVVE---AALMGVDIV-TMPFAVLEKLFKHPMTDLGIERFMEDWKKYLENL--
65 PsiBlast_CBE 90.5550%-114 - C3 -3S1U TAL_THEAC E:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
55 PsiBlast_CBE 90.3158%-118 - C3 -3R8R TAL_BACSU C:[1-210] MLFFVDTANID-----EIREANELGILAGVTTNPSL-----------------------------------------FH--------------------D----------------------R----LR---------------------------------EI----T--------DV---------V-KGSVSAEV---IS---LKAEEMIEEG-KELAKI--A-------PN-------ITVKIPMTSDGLKAVRALT-DLGIKTNVTLIFNANQALLAARAGAT-----------------YVSPFLGRLDD--------------I---------G--------------H----------N--GLDLISEVKQIFDIH------------GL-DTQIIAAS--IRHPQHVTE---AALRGAHIG-TMPLKVIHALTKHPLTDKGIEQFLADW---------
1 PsiBlast_PDB 90.3156%-124 - C3 -1VPX - TAL_THEMA A:[13-224] MKIFLDTANLE-----EIKKGVEWGIVDGVTTNP-----------------------------------------------------------------Q----------------------R----VK---------------------------------EI----C--------DL---------V-KGPVSAEV---VS---LDYEGMVREA-RELAQI--S-------EY-------VVIKIPMTPDGIKAVKTLS-AEGIKTNVTLVFSPAQAILAAKAGAT-----------------YVSPFVGRMDD--------------L---------S--------------N----------D--GMRMLGEIVEIYNNY------------GF-ETEIIAAS--IRHPMHVVE---AALMGVDIV-TMPFAVLEKLFKHPMTDLGIERFMEDWKKY------
39 PsiBlast_CBE 90.1556%-115 - C3 -1VPX TAL_THEMA B:[13-219] MKIFLDTANLE-----EIKKGVEWGIVDGVTTNPTLISKE---------GA--------------------E-----FK--------------------Q----------------------R----VK---------------------------------EI----C--------DL---------V-KGPVSAEV---VS---LDYEGMVREA-RELAQI--S-------EY-------VVIKIPMTPDGIKAVKTLS-AEGIKTNVTLVFSPAQAILAAKAGAT-----------------YVSPFVGRMDD--------------L---------S--------------N----------D--GMRMLGEIVEIYNNY------------GF-ETEIIAAS--IRHPMHVVE---AALMGVDIV-TMPFAVLEKLFKHPMTDLGIERFME-----------
4 PsiBlast_PDB 90.0850%-115 - C3 -3S1U TAL_THEAC A:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
23 PsiBlast_CBE 89.5156%-121 - C3 -1VPX TAL_THEMA R:[13-224] MKIFLDTANLE-----EIKKGVEWGIVDGVTTNPT---------------A--------------------E-----FK--------------------Q----------------------R----VK---------------------------------EI----C--------DL---------V-KGPVSAEV---VS---LDYEGMVREA-RELAQI--S-------EY-------VVIKIPMTPDGIKAVKTLS-AEGIKTNVTLVFSPAQAILAAKAGAT-----------------YVSPFVGRMDD--------------L---------S--------------N----------D--GMRMLGEIVEIYNNY------------GF-ETEIIAAS--IRHPMHVVE---AALMGVDIV-TMPFAVLEKLFKHPMTDLGIERFMEDWKKY------
69 PsiBlast_CBE 89.2350%-110 - C3 -3S1W TAL_THEAC E:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVAIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
70 PsiBlast_CBE 88.8450%-109 - C3 -3S1W TAL_THEAC D:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVAIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
3 PsiBlast_PDB 88.7850%-111 - C3 -3S0C TAL_THEAC A:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
64 PsiBlast_CBE 88.7550%-113 - C3 -3S1V TAL_THEAC B:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
61 PsiBlast_CBE 88.7350%-112 - C3 -3S1V TAL_THEAC E:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
63 PsiBlast_CBE 88.6450%-112 - C3 -3S1V TAL_THEAC C:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
58 PsiBlast_CBE 88.5350%-111 - C3 -3S1X TAL_THEAC D:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
71 PsiBlast_CBE 88.5150%-106 - C3 -3S1W TAL_THEAC C:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVAIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
88 HHSearch 88.4850%-110 - C3 -3S1X TAL_THEAC A:[1-219] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKE---------AV--------------------NGKK--YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVSPDG--
59 PsiBlast_CBE 88.3450%-112 - C3 -3S1X TAL_THEAC C:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
6 PsiBlast_PDB 88.1750%-110 - C3 -3S1X TAL_THEAC A:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
67 PsiBlast_CBE 88.1550%-110 - C3 -3S1U TAL_THEAC C:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
72 PsiBlast_CBE 88.0050%-111 - C3 -3S1W TAL_THEAC B:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVAIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
62 PsiBlast_CBE 87.9650%-112 - C3 -3S1V TAL_THEAC D:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
68 PsiBlast_CBE 87.7450%-112 - C3 -3S1U TAL_THEAC B:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
8 PsiBlast_PDB 87.7450%-109 - C3 -3S1W TAL_THEAC A:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVAIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
60 PsiBlast_CBE 87.6450%-110 - C3 -3S1X TAL_THEAC B:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
57 PsiBlast_CBE 87.2250%-112 - C3 -3S1X TAL_THEAC E:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
5 PsiBlast_PDB 86.9050%-111 - C3 -3S1V TAL_THEAC A:[1-216] MKIFLDTANID-----EIRTGVNWGIVDGVTTNPTLISKEAVN------GK--------------------K-----YG--------------------D----------------------I----IR---------------------------------EI----L--------KI---------V-DGPVSVEV---VS---TKYEGMVEEA-RKIHGL--G-------DN-------AVVKIPMTEDGLRAIKTLS-SEHINTNCTLVFNPIQALLAAKAGVT-----------------YVSPFVGRLDD--------------I---------G--------------E----------D--GMQIIDMIRTIFNNY------------II-KTQILVAS--IRNPIHVLR---SAVIGADVV-TVPFNVLKSLMKHPKTDEGLAKFLEDWKKVS-----
94 HHSearch 68.8134% -94 - C3 -3HJZ TAL_PROM9 A:[14-260] -VVVADTGDLD-----SIKKFQ----PRDATTNPSLILAA---------AK--------------------NPD---YV--------------------K----------------------L----IDKAIESSENTLPNGFSEIELIKETVDQVSVFFGKEI----L--------KI---------I-SGRVSTEV---DARLSFDTEATVKKA-RKLINL--YKNFGIEKER-------ILIKIAATWEGIKAAEILE-KEGIKCNLTLLFNFCQAVTCANANIT-----------------LISPFVGRILD--------------W---------HKAKTGKTSFIGAE-D----------P--GVISVTQIYKYFKEK------------GF-KTEVMGAS--FRNLDEIKE-----LAGCDLL-TIAPKFLEELKREK----------------------
12 PsiBlast_PDB 67.3231%-117 - C3 -3TNO ? A:[111-280] ------------------------------------------------------------------------------------------------------------------------------------------------------------------KI----L--------DV---------I-EGKVSSEVDARVS---FNSATTIDYAKRIIARY--E-------SNGIPKDR-VLIKIAATWEGIKAAKLLQ-KEGINCNLTLIFDKAQAKACAEAGVY-----------------LVSPFVGRITDWQMQQNNLKTFPAIA---------D--------------D----------D--GVNSVKAIYKLYKSH------------GF-KTIVMGAS--FRNVEQV-----IALAGCDAL-TISPVLLEEL--------------------------
11 PsiBlast_PDB 67.3031%-116 - C3 -3TK7 ? A:[111-280] ------------------------------------------------------------------------------------------------------------------------------------------------------------------KI----L--------DV---------I-EGKVSSEVDARVS---FNSATTIDYAKRIIARY--E-------SNGIPKDR-VLIKIAATWEGIKAAKLLQ-KEGINCNLTLIFDKAQAKACAEAGVY-----------------LVSPFVGRITDWQMQQNNLKTFPAIA---------D--------------D----------D--GVNSVKAIYKLYKSH------------GF-KTIVMGAS--FRNVEQV-----IALAGCDAL-TISPVLLEEL--------------------------
83 PsiBlast_CBE 66.9831%-116 - C3 -3UPB ? B:[111-290] ------------------------------------------------------------------------------------------------------------------------------------------------------------------KI----L--------DV---------I-EGKVSSEVDARVS---FNSATTIDYAKRIIARY--E-------SNGIPKDR-VLIKIAATWEGIKAAKLLQ-KEGINCNLTLIFDKAQAKACAEAGVY-----------------LVSPFVGRITDWQMQQNNLKTFPAIA---------D--------------D----------D--GVNSVKAIYKLYKSH------------GF-KTIVMGAS--FRNVEQV-----IALAGCDAL-TISPVLLEEL--------------------------
91 HHSearch 66.9430%-100 - C3 -3CQ0 TAL2_YEAST A:[24-269] THVVADSGDFE-----AISKYE----PQDSTTNPSLILAA---------SKLEKYARFIDAAVEYGRKHGKT-----DH--------------------E----------------------KIENAMDKILVEFGT-------------------------QI----L--------KV---------V-PGRVSTEV---DARLSFDKKATVKKA-LHIIKL--YKDAGVPKER-------VLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVT-----------------LISPFVGRIMD--------------FYKALDYTAET--------------D----------P--GVLSVKKIYSYYKRH------------GY-ATEVMAAS--FRNLDELK-----ALAGIDNM-TLPLNLLEQLYESTD---------------------
13 PsiBlast_PDB 66.4831%-116 - C3 -3UPB ? A:[111-290] ------------------------------------------------------------------------------------------------------------------------------------------------------------------KI----L--------DV---------I-EGKVSSEVDARVS---FNSATTIDYAKRIIARY--E-------SNGIPKDR-VLIKIAATWEGIKAAKLLQ-KEGINCNLTLIFDKAQAKACAEAGVY-----------------LVSPFVGRITDWQMQQNNLKTFPAIA---------D--------------D----------D--GVNSVKAIYKLYKSH------------GF-KTIVMGAS--FRNVEQV-----IALAGCDAL-TISPVLLEEL--------------------------
96 HHSearch 65.3232% -89 - C3 -3TKF ? A:[38-294] -MVVADTGDFE-----LIKKYKP----VDATTNPSLILKA---------VK--------------------EQK---YSNLVAETISKVKANNPDLNSDD----------------------L----VK---------------------------------EIAIEILVSFGIKILDV---------I-EGKVSSEV---DARVSFNSATTIDYA-KRIIAR--YESNGIPKDR-------VLIMIAATWEGIKAAKLLQ-KEGINCNLTLIFDKAQAKACAEAGVY-----------------LVSPFVGRITD--------------W---------QMQQNNLKTFPAIADD----------D--GVNSVKAIYKLYKSH------------GF-KTIVMGAS--FRNVEQVI-----ALAGCDAL-TISPVLLEELKNRD----------------------