@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0505: (2016-03-16 )
VAKIVPSVFGADIGRINEQLQVLEKNDIDLLHVDMMDGSFVPNIAFGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTHLHRTIQLIKSYGVRAGVVLNPGTPPSTLEYVLDDIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIGNRPIQIEVDGGVNDELAKECTLAGADLIVVGSYLFEGDIEANLEKLAKGVLTE

Atome Classification :

(25 SA) ---------.........10........20........30........40........50.....--...60........70........80........--90.--..--.-....100.......110.......120......---.130.......140.......150...---....160..--.--...--.170.......180.......190......-.200........210....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---------VAKIVPSVFGADIGRINEQLQVLEKNDIDLLHVDMMDGSFVPNIAFGPDQIKMMKK--GTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVH--QEA--TT--H-LHRTIQLIKSYGVRAGVVLNPGTPPSTLEYVLD---DIDCILLMTVNPGLGGQKFFQSSLEKI---RKTKAYIGN--R--PIQ--IEVDGGVNDELAKECTLAGADLIVVGSYLF-EGD-IEANLEKLAKGVLTE
54 HHSearch 97.9044%-134 - C2 -2FLI ? A:[4-219] ----------LKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDEKGL--SFD--IEVDGGVDNKTIRACYEAGANVFVAGSYLF-KASDLVSQVQTLRTALN--
74 Fugue 95.0943%-130 - C2 -1RPX RPE_SOLTU A:[1-230] SRVDKFSKSDIIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRP--ITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVH--CEQSSTI--H-LHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLD---AVDLVLIMSVNPGFGGQSFIESQVKKI---SDLRKICAE--RGLNPW--IEVDGGVGPKNAYKVIEAGANALVAGSAVFGAPD-YAEAIKGIKTSKRPE
29 PsiBlast_CBE 94.9946%-137 - C2 -2FLI ? D:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
24 PsiBlast_CBE 94.6146%-139 - C2 -2FLI ? I:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
71 HHSearch 94.5442%-132 - C2 -1RPX RPE_SOLTU A:[11-229] ----------IIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRP--ITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVH--CEQ--SSTIH-LHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLD---AVDLVLIMSVNPGFGGQSFIESQVKKI---SDLRKICAERGL--NPW--IEVDGGVGPKNAYKVIEAGANALVAGSAVF-GAPDYAEAIKGIKTSKRP-
1 PsiBlast_PDB 93.7846%-138 - C2 -2FLI ? A:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
31 PsiBlast_CBE 93.7546%-137 - C2 -2FLI ? B:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
2 PsiBlast_PDB 93.7548%-142 - C2 -1RPX RPE_SOLTU A:[13-211] ------------VSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRP--ITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSS--TI--H-LHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLD---AVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGL--N--P-W--IEVDGGVGPKNAYKVIEAGANALVAGSAVF--------------------
27 PsiBlast_CBE 93.6646%-137 - C2 -2FLI ? F:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
30 PsiBlast_CBE 93.6146%-137 - C2 -2FLI ? C:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
25 PsiBlast_CBE 93.4246%-135 - C2 -2FLI ? H:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
26 PsiBlast_CBE 93.4146%-137 - C2 -2FLI ? G:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
22 PsiBlast_CBE 93.1446%-137 - C2 -2FLI ? K:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
28 PsiBlast_CBE 93.1046%-136 - C2 -2FLI ? E:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
23 PsiBlast_CBE 93.0346%-133 - C2 -2FLI ? J:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
21 PsiBlast_CBE 93.0246%-136 - C2 -2FLI ? L:[5-204] -----------KIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRK--HSKLVFDCHLMVVDPERYVEAFAQAGADIMTIH--TES--TR--H-IHGALQKIKAAGMKAGVVINPGTPATALEPLLD---LVDQVLIMTVNPGFGGQAFIPECLEKV---ATVAKWRDE--K--GLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLF-KA-----------------
33 PsiBlast_CBE 92.5048%-142 - C2 -1RPX RPE_SOLTU B:[13-211] ------------VSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRP--ITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSS--TI--H-LHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLD---AVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGL--N--P-W--IEVDGGVGPKNAYKVIEAGANALVAGSAVF--------------------
32 PsiBlast_CBE 92.4148%-142 - C2 -1RPX RPE_SOLTU C:[13-211] ------------VSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRP--ITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSS--TI--H-LHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLD---AVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGL--N--P-W--IEVDGGVGPKNAYKVIEAGANALVAGSAVF--------------------
66 HHSearch 90.0037%-124 * C2 *1H1Y RPE1_ORYSJ A:[7-223] ----------AKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRK--HTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFH--IEV--SR--DNWQELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKV---RALRKKY----P--SLD--IEVDGGLGPSTIDVAASAGANCIVAGSSIF-GAAEPGEVISALRKSVEG-
67 HHSearch 89.9940%-131 - C2 -1TQJ - RPE_SYNY3 A:[5-223] ----------IVVAPSILSADFSRLGEEIKAVDEAGADWIHVDVMDGRFVPNITIGPLIVDAIRP--LTKKTLDVHLMIVEPEKYVEDFAKAGADIISVH--VEH--NASPH-LHRTLCQIRELGKKAGAVLNPSTPLDFLEYVLP---VCDLILIMSVNP----QSFIPEVLPKI---RALRQMCDERGL--DPW--IEVDGGLKPNNTWQVLEAGANAIVAGSAVF-NAPNYAEAIAGVRNSKRP-
38 PsiBlast_CBE 88.2235%-122 - C2 -3OVQ RPE_HUMAN B:[5-219] ----------CKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFH--LEA--TE--N-PGALIKDIRENGMKVGLAIKPGTSVEYLAPWAN---QIDMALVMTVEPGFGGQKFMEDMMPKV---HWLRTQFPS------LD--IEVDGGVGPDTVHKCAEAGANMIVSGSAIM-RSE-DPRSVINLLRNVCSE
37 PsiBlast_CBE 87.7635%-119 - C2 -3OVR RPE_HUMAN B:[5-219] ----------CKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFH--LEA--TE--N-PGALIKDIRENGMKVGLAIKPGTSVEYLAPWAN---QIDMALVMTVEPGFGGQKFMEDMMPKV---HWLRTQFPS------LD--IEVDGGVGPDTVHKCAEAGANMIVSGSAIM-RSE-DPRSVINLLRNVCSE
8 PsiBlast_PDB 87.6535%-121 - C2 -3OVR RPE_HUMAN A:[5-219] ----------CKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFH--LEA--TE--N-PGALIKDIRENGMKVGLAIKPGTSVEYLAPWAN---QIDMALVMTVEPGFGGQKFMEDMMPKV---HWLRTQFPS------LD--IEVDGGVGPDTVHKCAEAGANMIVSGSAIM-RSE-DPRSVINLLRNVCSE
14 PsiBlast_PDB 87.2133%-124 - C2 -3QC3 RPE_HUMAN A:[6-220] ----------CKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFH--LEA--TE--N-PGALIKDIRENGMKVGLAIKPGTSVEYLAPWAN---QIDMALVMTVEPGFGGQKFMEDMMPKV---HWLRTQFPS------LD--IEVDGGVGPDTVHKCAEAGANMIVSGSAIM-RSE-DPRSVINLLRNVCSE
7 PsiBlast_PDB 87.1735%-120 - C2 -3OVQ RPE_HUMAN A:[5-219] ----------CKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFH--LEA--TE--N-PGALIKDIRENGMKVGLAIKPGTSVEYLAPWAN---QIDMALVMTVEPGFGGQKFMEDMMPKV---HWLRTQFPS------LD--IEVDGGVGPDTVHKCAEAGANMIVSGSAIM-RSE-DPRSVINLLRNVCSE