@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0509: (2016-03-16 )
MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINIEESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKARSREPITAKLMANLIQRAGANRLITVDLHAAQIQGFFNIPIDHLSAIPLIGDYLIENYGEKDVVVVAPDHSGVVRARRIADRLNAPIAILNRKPRPHEDEIMSVIGDVKGKVAIVVDDIIDTGVRATTSADILLEKGAVEVIACATHSVMAGNATERLQNSNIKEVITSDSIDLPEDKQFDKLTTISIGRILGRAIEGVQENRSLHPLF

Atome Classification :

(29 SA) .........10........20........30........40........50........60........70........80........90........100.-.-.....----110.......120.......130.......140.......150........160.-...-....170.......180.......190.-.-.---....200.......210.......220.......230.......240.......250.-......260.......270....-...---280.......290.......300.......310
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINIEESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKAR-S-REPIT----AKLMANLIQRAGANRLITVDLHAAQIQGFFNIPIDHLSAIP-LIGDYLIENYG-E-KDV-VVVAPDHSGVVRARRIADRLNAPIAILN-R-K---PRPHEDEIMSVIGDVKGKVAIVVDDIIDTGVRATTSADILLEKGAVEVIACATHSVMA-GNATERLQNSNIKEVITSDSIDL-PED---KQFDKLTTISIGRILGRAIEGVQENRSLHPLF
1 PsiBlast_PDB 97.0056%-147 - C5 -1DKU KPRS_BACSU A:[10-316] ----LKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKAR-S-REPIT----AKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVP-ILGEYF-EGKN-L-EDI-VIVSPDHGGVTRARKLADRLKAPIAIIDKR-------------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLS-GPAVERINNSTIKELVVTNSIKL--------KIERFKQLSVGPLLAEAIIRVHEQQSVSYLF
22 PsiBlast_CBE 96.9856%-147 - C5 -1DKR KPRS_BACSU B:[10-316] ----LKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKAR-S-REPIT----AKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVP-ILGEYF-EGKN-L-EDI-VIVSPDHGGVTRARKLADRLKAPIAIIDKR-------------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLS-GPAVERINNSTIKELVVTNSIKL-PEE---KKIERFKQLSVGPLLAEAIIRVHEQQSVSYLF
21 PsiBlast_CBE 96.8156%-148 - C5 -1DKU KPRS_BACSU B:[10-316] ----LKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKAR-S-REPIT----AKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVP-ILGEYF-EGKN-L-EDI-VIVSPDHGGVTRARKLADRLKAPIAIIDKR-------------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLS-GPAVERINNSTIKELVVTNSIKL--------KIERFKQLSVGPLLAEAIIRVHEQQSVSYLF
47 Fugue 96.3055%-140 - C5 -1DKU KPRS_BACSU A:[9-316] ---NLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKAR-S-REPIT----AKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVP-ILGEYFEGK-N-L-EDI-VIVSPDHGGVTRARKLADRLKAPIAIID-K-R-----------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLS-GPAVERINNSTIKELVVTNSIK--------LKIERFKQLSVGPLLAEAIIRVHEQQSVSYLF
60 HHSearch 95.9956%-143 - C5 -1DKU KPRS_BACSU A:[9-316] ---NLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKAR-S-REPIT----AKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVP-ILGEYFEGKN--L-EDI-VIVSPDHGGVTRARKLADRLKAPIAIIDKR-------------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLS-GPAVERINNSTIKELVVTNSIKL--------KIERFKQLSVGPLLAEAIIRVHEQQSVSYLF
10 PsiBlast_PDB 93.2741%-139 - C5 -3S5J PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
58 HHSearch 93.1842%-136 * C5 *3S5J PRPS1_HUMAN B:[3-313] ---NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENISEW-RNC-TIVSPDAGGAKRVTSIADRLNVDFALIHKE-----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTIPQ-EDKM--KHCSKIQVIDISMILAEAIRRTHNGESVSYLF
5 PsiBlast_PDB 93.0641%-139 - C5 -4LYG PRPS1_HUMAN A:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVTIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
27 PsiBlast_CBE 93.0241%-141 - C5 -4LYG PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVTIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KER---K-----DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
35 PsiBlast_CBE 92.9041%-141 - C5 -4M0P PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANTLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
26 PsiBlast_CBE 92.6241%-139 - C5 -4LZO PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTTVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
31 PsiBlast_CBE 92.6041%-138 - C5 -2HCR PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
28 PsiBlast_CBE 92.4341%-137 - C5 -2H08 PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLMAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
13 PsiBlast_PDB 92.3841%-136 - C5 -4M0P PRPS1_HUMAN A:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANTLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
9 PsiBlast_PDB 92.3641%-140 - C5 -3EFH PRPS1_HUMAN A:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KER---K-------MVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
32 PsiBlast_CBE 92.3541%-134 - C5 -2H06 PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
34 PsiBlast_CBE 92.3241%-137 - C5 -4LZN PRPS1_HUMAN A:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINNNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
12 PsiBlast_PDB 92.2941%-138 - C5 -4LZN PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINNNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
11 PsiBlast_PDB 92.2441%-138 - C5 -4F8E PRPS1_HUMAN A:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEHVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KER----------RMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
25 PsiBlast_CBE 92.1642%-138 - C5 -2H07 PRPS1_HUMAN B:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHAAQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KE----------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
8 PsiBlast_PDB 91.8741%-139 - C5 -2HCR PRPS1_HUMAN A:[4-313] ----IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDK-S-RAPIS----AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEP-AVLKWIRENIS-EWRNC-TIVSPDAGGAKRVTSIADRLNVDFALIH-KER---------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFS-GPAISRINNACFEAVVVTNTI---PQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
24 PsiBlast_CBE 89.5042%-135 - C5 -3DAH ? B:[8-316] ----LMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRPR-SARVAIS----AKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRKQNY----PDL-LVVSPDVGGVVRARALAKQLNCDLA---------------------IGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLS-GGAADRIAASALDELVVTDTIPLSAES---LACPKIRALSSAGLLAETFSRIRRGDSVMSLF
23 PsiBlast_CBE 88.8342%-136 - C5 -3DAH ? C:[8-313] ----LMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRPR-SARVAIS----AKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRKQNY----PDL-LVVSPDVGGVVRARALAKQLNCDLAIIDKR-R----------VMNIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLS-GGAADRIAASALDELVVTDTIPLSAES---LACPKIRALSSAGLLAETFSRIRRGDSVM---
59 HHSearch 84.9740%-128 - C5 -3DAH ? A:[6-315] --DGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPTN<