@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0608: (2016-03-17 )
MSGPGPGGGMRMQTAAKPKNFKQTLFRLLGYMKPRSVAIIVVFIFAILSTIFNIFSPKELGKATTEIFKGVMSQDGINNDKIFNILMIVLVLYLGSSLFSFIQQYVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSLTQAITAIVQMIGVLIMMLTISWQMTLIVLVTVPISIILVAIIAGRSQRYFGAQQRNLGILNDTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYFKAAKKAQFISGIMMPVMQFVGNLGYVGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISSVANIANIIQSTIASAERVFEMMDEEEEKDEIPANVNQVAGEEHSIVFDHVKFGYTPDKPLMTDLNIHVEEGQMVAIVGPTGAGKTTIINLLMRFYDVDGGQIRMKGIDTRDMTKDAVREKFGMVLQDTWLFNGTIADNIAYGREGATKDEVIGAAKAAYADDFIRRLPNGYDTILNEEGSNISQGQKQLLTIARAILSDPSILILDEATSSVDTRTELNIQLAMGNLMEGRTSFVIAHRLSTIRDADLILVMNHGSVIEQGTHQELLDAKGFYADLYNSQFTGAQAV

Atome Classification :

(46 SA) .........10.......--.20........30.......-.40........50........60........70........80--........90........---------100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210........220.......230.......240.......250.......260.......270.......280.......290.......300.......310......-.320.......330.......340...-....350.---.......360--........370.--..--.--.---..380........390.......400.......410....---...420....--...430.......440.......-450......--------.460-.---.---......470.-......480.......490.......500.......510.......520.......530.......540....--.--..550.......560.-......570.......580...-.-.--..590......-.600...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSGPGPGGGMRMQTAAKP--KNFKQTLFRLLGYMKPRSVA-IIVVFIFAILSTIFNIFSPKELGKATTEIFKGVMSQDGINNDK--IFNILMIVLVLYLGSSLF---------SFIQQYVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSLTQAITAIVQMIGVLIMMLTISWQMTLIVLVTVPISIILVAIIAGRSQRYF-GAQQRNLGILNDTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYFKAAKKAQFISGIMMPVMQFVGNLGYVGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISS-VANIANIIQSTIASAERVFEMMDEEEE-KDEIPA-N---VNQVAGEEH---SIVFDHVKFGYT--PD--K--P---LMTD-LNIHVEEGQMVAIVGPTGAGKTTIINLLMRFYDVD---GGQIRMKGID--TRDMTKDAVREKFGMVLQDTWLF-NGTIADNIA--------YG-R-E---G---ATKDEVIGAA-KAAYADDFIRRLPNGYDTILNEEGSNISQGQKQLLTIARAILSDPSILILDEATSSVDTRTELNIQLAMGNLM--E--GRTSFVIAHRLSTIRD-ADLILVMNHGSVIEQGTHQELL-D-A--KGFYADLYNSQ-FTGAQAV
4 PsiBlast_PDB 89.4044%-110 - C1 -4Q4J - Y288_THEMA B:[15-591] ----------------KPALKNPTATLRRLLGYLRPHTFT-LIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPR------RFDL--LPRYMLILGTIYALTSLL---------FWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYF-YENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNE-LSNQFNMIQMALASAERIFEILDLEEE-KDDPDAVE---LREVRGE------IEFKNVWFSYD--KK--K--P---VLKD-ITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVD---RGQILVDGID--IRKIKRSSLRSSIGIVLQDTILF-STTVKENLK--------YG-N-P---G---ATDEEIKEAA-KLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATCNVDTKTEKSIQAAMWKLM--E--GKTSIIIAHRLNTIKN-ADLIIVLRDGEIVEMGKHDELI-Q-K--RGFYYELFTSQ-Y------
1 PsiBlast_PDB 89.0544%-109 - C1 -3QF4 Y288_THEMA B:[15-591] ----------------KPALKNPTATLRRLLGYLRPHTFT-LIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPR------RFDL--LPRYMLILGTIYALTSLL---------FWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYF-YENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNE-LSNQFNMIQMALASAERIFEILDLEEE-KDDPDAVE---LREVRGE------IEFKNVWFSYD--KK--K--P---VLKD-ITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVD---RGQILVDGID--IRKIKRSSLRSSIGIVLQDTILF-STTVKENLK--------YG-N-P---G---ATDEEIKEAA-KLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLM--E--GKTSIIIAHRLNTIKN-ADLIIVLRDGEIVEMGKHDELI-Q-K--RGFYYELFTSQ-Y------
2 PsiBlast_PDB 88.8144%-111 - C1 -4Q4A Y288_THEMA B:[15-591] ----------------KPALKNPTATLRRLLGYLRPHTFT-LIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPR------RFDL--LPRYMLILGTIYALTSLL---------FWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYF-YENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNE-LSNQFNMIQMALASAERIFEILDLEEE-KDDPDAVE---LREVRGE------IEFKNVWFSYD--KK--K--P---VLKD-ITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVD---RGQILVDGID--IRKIKRSSLRSSIGIVLQDTILF-STTVKENLK--------YG-N-P---G---ATDEEIKEAA-KLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLM--E--GKTSIIIAHRLNTIKN-ADLIIVLRDGEIVEMGKHDELI-Q-K--RGFYYELFTSQ-Y------
3 PsiBlast_PDB 88.2644%-106 - C1 -4Q4H - Y288_THEMA B:[15-591] ----------------KPALKNPTATLRRLLGYLRPHTFT-LIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPR------RFDL--LPRYMLILGTIYALTSLL---------FWLQGKIMLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILSLVTLSIVPLTVLITQIVSSQTRKYF-YENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNE-LSNQFNMIQMALASAERIFEILDLEEE-KDDPDAVE---LREVRGE------IEFKNVWFSYD--KK--K--P---VLKD-ITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVD---RGQILVDGID--IRKIKRSSLRSSIGIVLQDTILF-STTVKENLK--------YG-N-P---G---ATDEEIKEAA-KLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLM--E--GKTSIIIAHRLNTIKN-ADLIIVLRDGEIVEMGKHDELI-Q-K--RGFYYELFTSQ-Y------
122 Fugue 74.6334% -96 - C1 -3B60 MSBA_SALTY A:[10-581] -----------------------WQTFRRLWPTIAPFKAG-LIVAGIALILNAASDTFMLSLLKPLLDDGFGKT------DRSV--LLWMPLVVIGLMILRGIT---------SYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSIS-KNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS-LTNVNAQFQRGMAACQTLFAILDSEQE-KDEGKR-V---IDRATGD------LEFRNVTFTYPG-RE--V--P---ALRN-INLKIPAGKTVALVGRSGSGKSTIASLITRFYDID---EGHILMDGHD--LREYTLASLRNQVALVSQNVHLF-NDTVANNIA--------YA-RTE---E---YSREQIEEAA-RMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQ--K--NRTSLVIAHRLSTIEQ-ADEIVVVEDGIIVERGTHSELL-A-Q--HGVYAQLHKMQ-FG-----
102 HHSearch 74.5434% -97 - C1 -3B60 MSBA_SALTY A:[10-581] -----------------------WQTFRRLWPTIAPFKAG-LIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD------RSV--LLWMPLVVIGLMILRGIT---------SYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSIS-KNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS-LTNVNAQFQRGMAACQTLFAILDSEQE-KDEGKR-------VIDRATG---DLEFRNVTFTYP--GRE-V--P---ALRN-INLKIPAGKTVALVGRSGSGKSTIASLITRFYDID---EGHILMDGHD--LREYTLASLRNQVALVSQNVHLF-NDTVANNIA--------YA-R-TE--E---YSREQIEEAA-RMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQ--K--NRTSLVIAHRLSTIEQ-ADEIVVVEDGIIVERGTHSELL-A-Q--HGVYAQLHKMQ-FG-----
8 PsiBlast_PDB 74.1433%-100 - C1 -3B60 MSBA_SALTY A:[11-580] ------------------------QTFRRLWPTIAPFKAG-LIVAGIALILNAASDTF--------MLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLMILRGIT---------SYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSIS-KNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS-LTNVNAQFQRGMAACQTLFAILDSEQE-KDEGKR-V---IDRATGD------LEFRNVTFTY---PG--REVP---ALRN-INLKIPAGKTVALVGRSGSGKSTIASLITRFYDID---EGHILMDGHD--LREYTLASLRNQVALVSQNVHLF-NDTVANNIA--------YA-RTE---E---YSREQIEEAA-RMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQ--K--NRTSLVIAHRLSTIEQ-ADEIVVVEDGIIVERGTHSELL-A-Q--HGVYAQLHKMQ-F------
23 PsiBlast_CBE 73.8833%-100 - C1 -3B60 MSBA_SALTY B:[11-580] ------------------------QTFRRLWPTIAPFKAG-LIVAGIALILNAASDTF--------MLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLMILRGIT---------SYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSIS-KNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS-LTNVNAQFQRGMAACQTLFAILDSEQE-KDEGKR-V---IDRATGD------LEFRNVTFTY---PG--REVP---ALRN-INLKIPAGKTVALVGRSGSGKSTIASLITRFYDID---EGHILMDGHD--LREYTLASLRNQVALVSQNVHLF-NDTVANNIA--------YA-RTE---E---YSREQIEEAA-RMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQ--K--NRTSLVIAHRLSTIEQ-ADEIVVVEDGIIVERGTHSELL-A-Q--HGVYAQLHKMQ-F------
22 PsiBlast_CBE 73.7533%-100 - C1 -3B60 MSBA_SALTY C:[11-580] ------------------------QTFRRLWPTIAPFKAG-LIVAGIALILNAASDTF--------MLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLMILRGIT---------SYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSIS-KNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS-LTNVNAQFQRGMAACQTLFAILDSEQE-KDEGKR-V---IDRATGD------LEFRNVTFTY---PG--REVP---ALRN-INLKIPAGKTVALVGRSGSGKSTIASLITRFYDID---EGHILMDGHD--LREYTLASLRNQVALVSQNVHLF-NDTVANNIA--------YA-RTE---E---YSREQIEEAA-RMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQ--K--NRTSLVIAHRLSTIEQ-ADEIVVVEDGIIVERGTHSELL-A-Q--HGVYAQLHKMQ-F------
21 PsiBlast_CBE 73.6933%-100 - C1 -3B60 MSBA_SALTY D:[11-580] ------------------------QTFRRLWPTIAPFKAG-LIVAGIALILNAASDTF--------MLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLMILRGIT---------SYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSIS-KNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS-LTNVNAQFQRGMAACQTLFAILDSEQE-KDEGKR-V---IDRATGD------LEFRNVTFTY---PG--REVP---ALRN-INLKIPAGKTVALVGRSGSGKSTIASLITRFYDID---EGHILMDGHD--LREYTLASLRNQVALVSQNVHLF-NDTVANNIA--------YA-RTE---E---YSREQIEEAA-RMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQ--K--NRTSLVIAHRLSTIEQ-ADEIVVVEDGIIVERGTHSELL-A-Q--HGVYAQLHKMQ-F------
9 PsiBlast_PDB 73.5333%-100 - C1 -2HYD Y1866_STAAM A:[4-576] ----------------------------RYLQFVKPYKYR-IFATIIVGIIKFGIPMLIPLLIKYA----IDGVINNHALTTDE--KVHHLTIAI----GIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLT-RERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQS-FASMDRVFQLIDEDYDIKNGVGA-Q---PIEI--KQG---RIDIDHVSFQYN--DN--EA-P---ILKD-INLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVT---SGQILIDGHN--IKDFLTGSLRNQIGLVQQDNILF-SDTVKENIL--------LG-R-P---T---ATDEEVVEAA-KMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLS--K--DRTTLIVAHRLSTITH-ADKIVVIENGHIVETGTHRELI-A-K--QGAYEHLYSIQ--------
10 PsiBlast_PDB 73.2533%-101 - C1 -2ONJ Y1866_STAAM A:[4-576] ----------------------------RYLQFVKPYKYR-IFATIIVGIIKFGIPMLIPLLIKYA----IDGVINNHALTTDE--KVHHLTIAI----GIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLT-RERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQS-FASMDRVFQLIDEDYDIKNGVGA-Q---PIEI--KQG---RIDIDHVSFQYN--DN--EA-P---ILKD-INLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVT---SGQILIDGHN--IKDFLTGSLRNQIGLVQQDNILF-SDTVKENIL--------LG-R-P---T---ATDEEVVEAA-KMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLS--K--DRTTLIVAHRLSTITH-ADKIVVIENGHIVETGTHRELI-A-K--QGAYEHLYSIQ--------
31 PsiBlast_CBE 73.2433%-101 - C1 -2HYD Y1866_STAAM B:[4-576] ----------------------------RYLQFVKPYKYR-IFATIIVGIIKFGIPMLIPLLIKYA----IDGVINNHALTTDE--KVHHLTIAI----GIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLT-RERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQS-FASMDRVFQLIDEDYDIKNGVGA-Q---PIEI--KQG---RIDIDHVSFQYN--DN--EA-P---ILKD-INLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVT---SGQILIDGHN--IKDFLTGSLRNQIGLVQQDNILF-SDTVKENIL--------LG-R-P---T---ATDEEVVEAA-KMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLS--K--DRTTLIVAHRLSTITH-ADKIVVIENGHIVETGTHRELI-A-K--QGAYEHLYSIQ--------
30 PsiBlast_CBE 72.8133%-102 - C1 -2ONJ Y1866_STAAM B:[4-576] ----------------------------RYLQFVKPYKYR-IFATIIVGIIKFGIPMLIPLLIKYA----IDGVINNHALTTDE--KVHHLTIAI----GIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLT-RERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQS-FASMDRVFQLIDEDYDIKNGVGA-Q---PIEI--KQG---RIDIDHVSFQYN--DN--EA-P---ILKD-INLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVT---SGQILIDGHN--IKDFLTGSLRNQIGLVQQDNILF-SDTVKENIL--------LG-R-P---T---ATDEEVVEAA-KMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLS--K--DRTTLIVAHRLSTITH-ADKIVVIENGHIVETGTHRELI-A-K--QGAYEHLYSIQ--------
19 PsiBlast_PDB 72.7231% -99 * C1 *4F4C - PGP1_CAEEL A:[163-708] ---------------------------------------------------------------------------------------------------------------------------VAEQMNNRLRREFVKSILRQEISWFDTNHSGTLATKLFDNLERVKEGTGDKIGMAFQYLSQFITGFIVAFTHSWQLTLVMLAVTPIQALCGFAIAKSMSTFA-IRETLRYAKAGKVVEETISSIRTVVSLNGLRYELERYSTAVEEAKKAGVLKGLFLGISFGAMQASNFISFALAFYIGVGWVHDGSLNFGDMLTTFSSVMMGSMALGL-AGPQLAVLGTAQGAASGIYEVLDRKPV-IDSSSK-A---GRKDMKIKG---DITVENVHFTYPSRPD--V--P---ILRG-MNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDVL---KGKITIDGVD--VRDINLEFLRKNVAVVSQEPALF-NCTIEENIS--------LG-K-E---G---ITREEMVAAC-KMANAEKFIKTLPNGYNTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESEGIVQQALDKAA--K--GRTTIIIAHRLSTIRN-ADLIISCKNGQVVEVGDHRALM-A-Q--QGLYYDLVTAQTFTDA---
15 PsiBlast_PDB 72.6530%-101 - C1 -4AYX ABCBA_HUMAN A:[9-574] ----------------------------KLLGLAYPERRR-LAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVD---YSDN--LTRLCLGLSAVFLCGAAA---------NAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVP-PVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGG-LSSFYSELMKGLGAGGRLWELLERE----PKLPF-N---EGVILNEKSFQGALEFKNVHFAYPARPE--V--P---IFQD-FSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPA---SGTISLDGHD--IRQLNPVWLRSKIGTVSQEPILF-SCSIAENIA--------YG-A-DDPSS---VTAEEIQRVA-EVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLM--D--GRTVLVIAHRLSTIKN-ANMVAVLDQGKITEYGKHEELL-SKP--NG-----------------
16 PsiBlast_PDB 72.3030% -99 - C1 -3ZDQ ABCBA_HUMAN A:[9-572] ----------------------------KLLGLAYPERRR-LAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVD---YSDN--LTRLCLGLSAVFLCGAAA---------NAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVP-PVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGG-LSSFYSELMKGLGAGGRLWELLERE----PKLPF-N---EGVILNEKSFQGALEFKNVHFAYPARPE--V--P---IFQD-FSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPA---SGTISLDGHD--IRQLNPVWLRSKIGTVSQEPILF-SCSIAENIA--------YG-A-DDPSS---VTAEEIQRVA-EVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLM--D--GRTVLVIAHRLSTIKN-ANMVAVLDQGKITEYGKHEELL-SKP---------------------
104 HHSearch 70.7128% -98 - C1 -3WMG ? A:[14-598] --------------------------ARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQ----IEGE--TWKYSVGFVGIGVFEFIV---------AGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSK-LGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAVVVQMIEMSGNT-KRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQ-AAQVWPDVTRGLGAGGELFAMIDRVPQ-YRRPDP-GAEVVTQPLVLKQ---GIVFENVHFRYP--TRMNV--E---VLRG-ISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTP--AWNYDFHALRSQIGLVSQEPVLF-SGTIRDNIL--------YG-K-R---D---ATDEEVIQAL-REANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASD--GVTSVVIAHRLSTVAR-ADLILVMQDGVVVEQGNHSELM-A-LGPSGFYYQLVEKQ-LAS----