@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1083: (2016-03-21 )
MNLLVTGGAGFIGSNFVHHILNKHDDYKVVNLDLLTYAGTMSNLEDIKENPNHVFVEGNICDYDLVKKLVTDHKIDTIVNFAAESHVDRSIINPGIFIETNVQGTLNLLNVAKELNVAKYLQVSTDEVYGSLGETGYFTEETPIAPNSPYSASKASADLLVRSYFETYGLNVNITRCSNNYGPHHFPEKLIPLMITNGLDGENLPIYGDGKNIRDWLHVSDHCAAIDLVIHNGKSGEVYNVGGHNERTNNEIVHIIVDDLNLSKDKIVYVEDRLGHDLRYAIDPKKIETELGWEPKYTFDTGIKETIEWYVNNEAWWRPLKSRAKLGE

Atome Classification :

(27 SA) .........10........20-......------..30........40........50........60........70........80........90........100.......-110.---------..---------....120.......130-----------....----------...140........150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260------.-----------....-------...270.......280.......290.....-.-.300.......310.......320......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNLLVTGGAGFIGSNFVHHIL-NKHDDY------KVVNLDLLTYAGTMSNLEDIKENPNHVFVEGNICDYDLVKKLVTDHKIDTIVNFAAESHVDRSIINPGIFIETNVQGTLNLL-NVAK---------EL---------NVAKYLQVSTDEVYGSL-----------GETG----------YFTE-ETPIAPNSPYSASKASADLLVRSYFETYGLNVNITRCSNNYGPHHFPEKLIPLMITNGLDGENLPIYGDGKNIRDWLHVSDHCAAIDLVIHNGKSGEVYNVGGHNERTNNEIVHIIVDDLN-------L-----------SKDK-------IVYVEDRLGHDLRYAIDPKKIETELGWEPKY-T-FDTGIKETIEWYVNNEAWWRPLKSRAKLGE
1 PsiBlast_PDB 95.1759% -86 - C1 -4EGB ? A:[26-345] -NILVTGGAGFIGSNFVHYML-QSYETY------KIINFDALTYSGNLNNVKSIQDHPNYYFVKGEIQNGELLEHVIKERDVQVIVNFAAES---------IPFYDTNVIGTVTLL-ELVK---------KY---------PHIKLVQVSTDEVYGSL-----------GKTG----------RFTE-ETPLAPNSPYSSSKASADMIALAYYKTYQLPVIVTRCSNNYGPYQYPEKLIPLMVTNALEGKKLPLYGDGLNVRDWLHVTDHCSAIDVVLHKGRVGEVYNIGGNNEKTNVEVVEQIITLLG-------K-----------TKKD-------IEYVTD--GHDRRYAINAEKMKNEFDWEPKY-T-FEQGLQETVQWYEKNEEWWKPLK-------
45 HHSearch 90.0652% -88 - C1 -1R6D ? A:[1-320] MRLLVTGGAGFIGSHFVRQLL-AGA--YPDVPADEVIVLDSLTYAGNRANLAPVDADPRLRFVHGDIRDAGLLARELR--GVDAIVHFAAESHVDRSIAGASVFTETNVQGTQTLL-QCAV---------DA---------GVGRVVHVSTNQVYGSI-----------DS------------GSWTESSPLEPNSPYAASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAGGRAGEIYHIGGGLELTNRELTGILLDSLG-------A-----------DWSS-------VRKVADRKGHDLRYSLDGGKIERELGYRPQV-S-FADGLARTVRWYRENRGWWEP---------
3 PsiBlast_PDB 89.0651% -84 - C1 -1R66 ? A:[1-322] MRLLVTGGAGFIGSHFVRQLLAGAYPDVPAD---EVIVLDSLTYAGNRANLAPVDADPRLRFVHGDIRDAGLLAREL--RGVDAIVHFAAESHVDRSIAGASVFTETNVQGTQTLL-QCAV---------DA---------GVGRVVHVSTDEVYGSI------------DSG----------SWTE-SSPLEPNSPYAASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAGGRAGEIYHIGGGLELTNRELTGILLDSLG-------A-----------DWSS-------VRKVADRKGHDLRYSLDGGKIERELGYRPQV-S-FADGLARTVRWYRENRGWWEPLK-------
4 PsiBlast_PDB 89.0151% -85 - C1 -1R6D ? A:[1-322] MRLLVTGGAGFIGSHFVRQLLAGAYPDVPAD---EVIVLDSLTYAGNRANLAPVDADPRLRFVHGDIRDAGLLAREL--RGVDAIVHFAAESHVDRSIAGASVFTETNVQGTQTLL-QCAV---------DA---------GVGRVVHVSTNQVYGSI------------DSG----------SWTE-SSPLEPNSPYAASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAGGRAGEIYHIGGGLELTNRELTGILLDSLG-------A-----------DWSS-------VRKVADRKGHDLRYSLDGGKIERELGYRPQV-S-FADGLARTVRWYRENRGWWEPLK-------
2 PsiBlast_PDB 87.9253% -91 - C1 -2HUN ? A:[4-321] MKLLVTGGMGFIGSNFIRYIL-EKHPDW------EVINIDKLGYGSNPANLKDLEDDPRYTFVKGDVADYELVKELV--RKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRR---------EN---------PEVRFVHVSTDEVYGDI-----------LK-G----------SFTE-NDRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTNNYGPYQFPEKLIPKTIIRASLGLKIPIYGT---VRDWLYVEDHVRAIELVLLKGESREIYNISAGEEKTNLEVVKIILRLMG-------K-----------GEEL-------IELVEDRPGHDLRYSLDSWKITRDLKWRPKY-T-FDEGIKKTIDWYLKNEWWWKPL--------
48 HHSearch 87.3852% -89 - C1 -2HUN ? A:[4-323] MKLLVTGGMGFIGSNFIRYIL-EKHPDW------EVINIDKLGYGSNPANLKDLEDDPRYTFVKGDVADYELVKELVR--KVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLL-ESIR---------REN--------PEVRFVHVSTDEVYGDI-----------LKG------------SFTENDRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTNNYGPYQFPEKLIPKTIIRASLGLKIPIYGT---VRDWLYVEDHVRAIELVLLKGESREIYNISAGEEKTNLEVVKIILRLMG-------K-----------GEEL-------IELVEDRPGHDLRYSLDSWKITRDLKWRPKY-T-FDEGIKKTIDWYLKNEWWWKPLVD------
53 HHSearch 86.9547% -80 * C1 *1OC2 ? A:[5-331] KNIIVTGGAGFIGSNFVHYVY-NNHPDV------HVTVLDKLTYAGNKANLEAI-LGDRVELVVGDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLL-EAAR---------KY---------DI-RFHHVSTDEVYGDL-----------PLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMG-------Q-----------PKDA-------YDHVTDRAGHDLRYAIDASKLRDELGWTPQFTD-FSEGLEETIQWYTDNQDWWKA---------
26 PsiBlast_CBE 86.7349% -79 - C1 -1G1A RMLB_SALTY C:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
21 PsiBlast_CBE 86.7353% -88 - C1 -2HUN ? B:[4-321] MKLLVTGGMGFIGSNFIRYIL-EKHPDW------EVINIDKLGYGSNPANLKDLEDDPRYTFVKGDVADYELVKELV--RKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRR---------EN---------PEVRFVHVSTDEVYGDI-----------LK-G----------SFTE-NDRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTNNYGPYQFPEKLIPKTIIRASLGLKIPIYGTGKNVRDWLYVEDHVRAIELVLLKGESREIYNISAGEEKTNLEVVKIILRLMG-------K-----------GEEL-------IELVEDRPGHDLRYSLDSWKITRDLKWRPKY-T-FDEGIKKTIDWYLKNEWWWKPL--------
49 HHSearch 86.3753% -83 - C1 -1KEW RMLB_SALTY A:[1-348] MKILITGGAGFIGSAVVRHII-KNTQ-D------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTL--PLFTETTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLD-------E-----------IVPKATSYREQITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
25 PsiBlast_CBE 85.6249% -80 - C1 -1G1A RMLB_SALTY D:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
30 PsiBlast_CBE 85.1946% -80 - C1 -1KER ? B:[6-333] -NIIVTGGAGFIGSNFVHYVY-NNHPDV------HVTVLDKLTYAGNKANLEAILGDRVELVV-GDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLL-EAAR---------KY---------DI-RFHHVSTDEVYGDLPLREDLPGHGEGPGE----------KFTA-ETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMG-------Q-----------PKDA-------YDHVTDRAGHDLRYAIDASKLRDELGWTPQF-TDFSEGLEETIQWYTDNQDWWKAEK-------
27 PsiBlast_CBE 84.5149% -79 - C1 -1G1A RMLB_SALTY B:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
28 PsiBlast_CBE 84.4146% -78 - C1 -1OC2 ? B:[6-333] -NIIVTGGAGFIGSNFVHYVY-NNHPDV------HVTVLDKLTYAGNKANLEAILGDRVELVV-GDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLL-EAAR---------KY---------DI-RFHHVSTDEVYGDLPLREDLPGHGEGPGE----------KFTA-ETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMG-------Q-----------PKDA-------YDHVTDRAGHDLRYAIDASKLRDELGWTPQF-TDFSEGLEETIQWYTDNQDWWKAEK-------
12 PsiBlast_PDB 84.0946% -77 - C1 -1OC2 ? A:[6-333] -NIIVTGGAGFIGSNFVHYVY-NNHPDV------HVTVLDKLTYAGNKANLEAILGDRVELVV-GDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLL-EAAR---------KY---------DI-RFHHVSTDEVYGDLPLREDLPGHGEGPGE----------KFTA-ETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMG-------Q-----------PKDA-------YDHVTDRAGHDLRYAIDASKLRDELGWTPQF-TDFSEGLEETIQWYTDNQDWWKAEK-------
23 PsiBlast_CBE 84.0249% -79 - C1 -1KEW RMLB_SALTY B:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
8 PsiBlast_PDB 84.0149% -79 - C1 -1KEW RMLB_SALTY A:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
6 PsiBlast_PDB 83.4749% -79 - C1 -1G1A RMLB_SALTY A:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
24 PsiBlast_CBE 82.9349% -77 - C1 -1KEU RMLB_SALTY B:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
29 PsiBlast_CBE 82.2846% -78 - C1 -1KET RMLB_STRMU B:[6-333] -NIIVTGGAGFIGSNFVHYVY-NNHPDV------HVTVLDKLTYAGNKANLEAILGDRVELVV-GDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLL-EAAR---------KY---------DI-RFHHVSTDEVYGDLPLREDLPGHGEGPGE----------KFTA-ETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMG-------Q-----------PKDA-------YDHVTDRAGHDLRYAIDASKLRDELGWTPQF-TDFSEGLEETIQWYTDNQDWWKAEK-------
7 PsiBlast_PDB 82.2449% -76 - C1 -1KEU RMLB_SALTY A:[1-348] MKILITGGAGFIGSAVVRHII-KNTQD-------TVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALL-EVAR---------KYWSALGEDKKNNFRFHHISTDEVYGDL-----------PHPDEVENSVTLP-LFTE-TTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATS-----------YREQ-------ITYVADRPGHDRRYAIDAGKISRELGWKPLE-T-FESGIRKTVEWYLANTQWVNNVKSGA----
31 PsiBlast_CBE 82.0646% -77 - C1 -1KEP RMLB_STRMU B:[6-333] -NIIVTGGAGFIGSNFVHYVY-NNHPDV------HVTVLDKLTYAGNKANLEAILGDRVELVV-GDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLL-EAAR---------KY---------DI-RFHHVSTDEVYGDLPLREDLPGHGEGPGE----------KFTA-ETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMG-------Q-----------PKDA-------YDHVTDRAGHDLRYAIDASKLRDELGWTPQF-TDFSEGLEETIQWYTDNQDWWKAEK-------
5 PsiBlast_PDB 82.0148% -75 - C1 -1BXK RMLB2_ECOLI A:[3-349] -KILITGGAGFIGSALVRYII-NETSD-------AVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLL-EAARAYWNALTEDKK---------SAFRFHHISTDEVYGDL-----------HSTDD---------FFTE-TTPYAPSSPYSASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATTGKVGETYNIGGHNERKNLDVVETICELLE-------ELAPNKPHGVAHYRDL-------ITF---------RYAIDASKIARELGCVPQE-T-FESGMRKTVQWYLANESWWKQVQDGSYQGE
9 PsiBlast_PDB 81.9046% -78 - C1 -1KEP RMLB_STRMU A:[6-333] -NIIVTGGAGFIGSNFVHYVY-NNHPDV------HVTVLDKLTYAGNKANLEAILGDRVELVV-GDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLL-EAAR---------KY---------DI-RFHHVSTDEVYGDLPLREDLPGHGEGPGE----------KFTA-ETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMG-------Q-----------PKDA-------YDHVTDRAGHDLRYAIDASKLRDELGWTPQF-TDFSEGLEETIQWYTDNQDWWKAEK-------