@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1093: (2016-03-21 )
MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVLGISGGQDSTLTGKLAQMAISEMRAETGDDEYRFFAVSLPYGTQLDESDRQDALNFMEPDNRLTVNIKASVDASVAALAEAGVELSDFAKGNEKARERMKVQYAIAAMHKGVVVGTDHSAEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALPDEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK

Atome Classification :

(33 SA) .........10........20........30........40........50........60........70........80.......--.90........100....--....110....----.-..120...-...-.130----........140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVLGISGGQDSTLTGKLAQMAISEMRAETGDDEYRFFAVSLPYGTQ--LDESDRQDALNF-MEPDN--RLTVNIKASVD----A-SVAALAEA-GVE-LSD-----FAKGNEKARERMKVQYAIAAMHKGVVVGTDHSAEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALPDEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK
5 PsiBlast_PDB 96.6268% -63 - C4 -1WXI NADE_ECOLI A:[2-274] -TLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGVQ--ADEQDCQDAIAF-IQPDR--VLTVNIKGAVL----A-SEQALREA-GIE-LSD-----FVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYKKA-------------DEVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWK
2 PsiBlast_PDB 96.5068% -71 - C4 -1WXF - NADE_ECOLI A:[2-274] -TLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGV-----EQDCQDAIAF-IQPDR--VLTVNIKGAVL----A-SEQALREA-GIE-LSD-----FVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYK----------------EVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWK
4 PsiBlast_PDB 95.6668% -71 - C4 -1WXH NADE_ECOLI A:[2-274] -TLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGV-----EQDCQDAIAF-IQPDR--VLTVNIKGAVL----A-SEQALREA-GIE-LSD-----FVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYK----------------EVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWK
37 HHSearch 95.4168% -61 - C4 -1WXI NADE_ECOLI A:[2-274] -TLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGVQ--ADEQDCQDAIAFIQPDRV---LTVNIKGAVL----A-SEQALREA-GIE-LSD-----FVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYKKA-------------DEVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWK
6 PsiBlast_PDB 95.2967% -65 - C4 -3HMQ NADE_SALTY A:[3-274] --LQQEIIQALGAKPHINPEEEIRRSVDFLKAYLKTYPFLKSLVLGISGGQDSTLAGKLSQMAIAELREETGDNALQFIAVRLPYGVQ--ADEQDCQDAIAF-IQPDR--VLTVNIKGAVL----A-SEQALREA-GIE-LSD-----FVRGNEKARERMKAQYSIAGMTHGVVVGTDHAAEAITGFFTKYGDGGTDINPLHRLNKRQGKQLLAALGCPEHLYKK-------------PDEAALGVTYDNIDDYLEGKTLDPAIAKTIEGWYVKTEHKRRLPITVFDDFWK
1 PsiBlast_PDB 95.2868% -69 - C4 -1WXE NADE_ECOLI A:[2-274] -TLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGVQ--ADEQDCQDAIAF-IQPDR--VLTVNIKGAVL----A-SEQALREA-GIE-LSD-----FVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYK----------------EVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWK
3 PsiBlast_PDB 95.1068% -69 - C4 -1WXG NADE_ECOLI A:[2-274] -TLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGV-----EQDCQDAIAF-IQPDR--VLTVNIKGAVL----A-SEQALREA-GIE-LSD-----FVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYK----------------EVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWK
15 PsiBlast_PDB 90.8154% -53 - C4 -4Q16 NADE_DEIRA A:[11-280] --LRSHIIRELHVQPDIDPGAEVERRVAFLCDYLQ-STPTKGFVLGISGGQDSTLAGRLCQLAVERRRSQ--GHGATFLAVRLPYGVQ--ADEADAQQALDF-IQADR--EVTVNIKEAAD----A-SVAAAQAALGSE-VRD-----FVRGNVKARERMVAQYALAGQENLLVVGTDHAAEALTGFYTKYGDGGVDLTPLSGLTKRQGAQLLAHLGAPEGTWRKVPTADL----PGLPDEVALGVTYAQIDAYLEGREVSDEAAARLERLFLNSRHKRALPVTPFDGWWQ
28 PsiBlast_CBE 90.7855% -48 - C4 -2PZA NADE_BACAN B:[1-272] MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGN--ATFIAVRLPYKVQ--KDEDDAQLALQF-IQADQ--SVAFDIASTVD----A-FSNQYENL-LDESLTD-----FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
29 PsiBlast_CBE 89.5655% -49 - C4 -2PZ8 NADE_BACAN B:[1-272] MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGN--ATFIAVRLPYKVQ--KDEDDAQLALQF-IQADQ--SVAFDIASTVD----A-FSNQYENL-LDESLTD-----FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
32 PsiBlast_CBE 88.9954% -56 - C4 -4Q16 NADE_DEIRA B:[11-280] --LRSHIIRELHVQPDIDPGAEVERRVAFLCDYLQ-STPTKGFVLGISGGQDSTLAGRLCQLAVERRRSQ--GHGATFLAVRLPYGVQ--ADEADAQQALDF-IQADR--EVTVNIKEAAD----A-SVAAAQAALGSE-VRD-----FVRGNVKARERMVAQYALAGQENLLVVGTDHAAEALTGFYTKYGDGGVDLTPLSGLTKRQGAQLLAHLGAPEGTWRK-------DDRPGLPDEVALGVTYAQIDAYLEGREVSDEAAARLERLFLNSRHKRALPVTPFDGWWQ
14 PsiBlast_PDB 88.9355% -44 - C4 -2PZA NADE_BACAN A:[1-272] MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGN--ATFIAVRLPYKVQ--KDEDDAQLALQF-IQADQ--SVAFDIASTVD----A-FSNQYENL-LDESLTD-----FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
16 PsiBlast_PDB 88.9050% -59 - C4 -3Q4G NADE_VIBCH A:[7-279] -----KIREEMRVLPSIDPQFEIERRVAFIKRKLTEARY-KSLVLGISGGVDSTTCGRLAQLAVEELNQQHNTTEYQFIAVRLPYGEQ--KDEDEAQLALSF-IRPTH--SVSVNIKAGVDGLHAA-SHHALANT-GLI-PSDPAKVDFIKGNVKARARMVAQYEIAGYVGGLVLGTDHSAENITGFYTKFGDGACDLAPLFGLNKRQVRLLAKTLGAPEQLVYKTPTAD-------------LNLTYEQIDDFLEGKAVPAEVSQRLVAIYHATQHKRQPIPTIYD----
13 PsiBlast_PDB 88.8655% -47 - C4 -2PZ8 NADE_BACAN A:[1-272] MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGN--ATFIAVRLPYKVQ--KDEDDAQLALQF-IQADQ--SVAFDIASTVD----A-FSNQYENL-LDESLTD-----FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
8 PsiBlast_PDB 88.6555% -49 - C4 -2NSY NADE_BACSU A:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
30 PsiBlast_CBE 88.5154% -53 - C4 -4Q16 NADE_DEIRA D:[11-280] --LRSHIIRELHVQPDIDPGAEVERRVAFLCDYLQ-STPTKGFVLGISGGQDSTLAGRLCQLAVERRRSQ--GHGATFLAVRLPYGVQ--ADEADAQQALDF-IQADR--EVTVNIKEAAD----A-SVAAAQAALGSE-VRD-----FVRGNVKARERMVAQYALAGQENLLVVGTDHAAEALTGFYTKYGDGGVDLTPLSGLTKRQGAQLLAHLGAPEGTWRKVPTAD----RPGLPDEVALGVTYAQIDAYLEGREVSDEAAARLERLFLNSRHKRALPVTPFDGWWQ
21 PsiBlast_CBE 88.4855% -47 - C4 -2NSY NADE_BACSU B:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
10 PsiBlast_PDB 88.4455% -52 - C4 -1FYD NADE_BACSU A:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
27 PsiBlast_CBE 88.3255% -67 - C4 -2PZB NADE_BACAN D:[1-272] MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGN--ATFIAVRLPYKV------DDAQLALQF-IQADQ--SVAFDIASTVD----A-FSNQYENL-LDESLTD-----FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYL---------------------ITYDQLDDYLEGKTVPADVAEKIEKRYTVS-------ASMFDDWWK
23 PsiBlast_CBE 87.9655% -47 - C4 -1KQP NADE_BACSU B:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
7 PsiBlast_PDB 87.9455% -50 - C4 -1NSY NADE_BACSU A:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
22 PsiBlast_CBE 87.8455% -51 - C4 -1NSY NADE_BACSU B:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
12 PsiBlast_PDB 87.6455% -48 - C4 -1IH8 NADE_BACSU A:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
9 PsiBlast_PDB 87.4855% -48 - C4 -1EE1 NADE_BACSU A:[2-271] --MQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKK-TGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGD--AQFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----AFSDQYQQET-GDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
58 Fugue 87.4055% -46 - C4 -2NSY NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGA-KGFVLGISGGQDSTLAGRLAQLAVESIREEGGDA--QFIAVRLPHGTQ--QDEDDAQLALKF-IKPDK--SWKFDIKSTVS----A-FSDQYQQETGDQ-LTD-----FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK