@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1494: (2016-03-25 )
MTIGIIGAMEEEVELLKNSMSSVEEIVIGGAKFYIGEIASKEVVLLESGIGKVNAALGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYREYFATSENKAVYGLVVTNDSFIMRPDQHEIIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEFIHLAAKQSATCIIELLKTI

Atome Classification :

(67 SA) .........10..-.-.....20........30........40........50........60........70........80........90........100.......110.......120.......130...-....140...-....150.......160.......170.......180.......190.......200.......210.......220....---...230.-
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTIGIIGAMEEEV-E-LLKNSMSSVEEIVIGGAKFYIGEIASKEVVLLESGIGKVNAALGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYRE-YFATSENKAV-YGLVVTNDSFIMRPDQHEIIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEFIHLAAKQSATCI---IELLKTI-
12 PsiBlast_PDB 95.2847%-118 - C1 -1ZOS ? A:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQ----IQE-SLSQLDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
70 Fugue 95.2348%-115 - C1 -1ZOS ? A:[1-230] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQ-----LDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKALD
80 HHSearch 95.0048%-115 - C1 -1ZOS ? A:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQ-----LDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
32 PsiBlast_CBE 94.9047%-120 - C1 -1ZOS ? D:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQ----IQE-SLSQLDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
33 PsiBlast_CBE 94.8147%-120 - C1 -1ZOS ? C:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQ----IQE-SLSQLDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
30 PsiBlast_CBE 94.5147%-121 - C1 -1ZOS ? F:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQ----IQE-SLSQLDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
31 PsiBlast_CBE 94.3847%-120 - C1 -1ZOS ? E:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQ----IQE-SLSQLDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
38 PsiBlast_CBE 94.3548%-126 - C1 -1Z5P MTNN_ECOLI A:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
34 PsiBlast_CBE 94.3547%-118 - C1 -1ZOS ? B:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNTQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQ----IQE-SLSQLDQNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
21 PsiBlast_CBE 93.9649%-113 - C1 -4X24 ? B:[1-231] MKIGIIGAMQQEV-A-ILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMPGQPAAFKADEKLMTVAEQALAQ-LPNT---HAV-RGLICTGDAFICTAEGQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK---
4 PsiBlast_PDB 93.5948%-119 - C1 -4G89 MTNN_KLEP7 A:[6-234] MKIGIIGAMEEEV-T-LLRDKIENRQTITIGGSEIYTGQLHGVDVALLKSGIGKVAAAMGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADEKLVAAAESCIKA-L----DLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHLSFEEFLAVAARQSTLMV---ENLVQNL-
48 PsiBlast_CBE 93.5148%-117 - C1 -3EEI ? B:[5-233] -TVAVIGAMEQEI-E-LLREMMENVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVPQLPARFASDGILIEAAKRAART-F----EGAAVEQGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAKMV---AEIVKSL-
49 PsiBlast_CBE 93.3448%-117 - C1 -3EEI ? A:[5-233] -TVAVIGAMEQEI-E-LLREMMENVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVPQLPARFASDGILIEAAKRAART-F----EGAAVEQGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAKMV---AEIVKSL-
3 PsiBlast_PDB 92.8949%-111 - C1 -4X24 ? A:[1-231] MKIGIIGAMQQEV-A-ILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMPGQPAAFKADEKLMTVAEQALAQ-LPNT---HAV-RGLICTGDAFICTAEGQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK---
7 PsiBlast_PDB 92.8052%-121 - C1 -4F1W ? A:[17-241] MKIGIIGAMEEEV-T-LLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRE-L----NLNAV-RGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS-TLM---VETL----
28 PsiBlast_CBE 92.7552%-114 - C1 -4F2P ? B:[17-241] MKIGIIGAMEEEV-T-LLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRE-L----NLNAV-RGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS-TLM---VETL----
81 HHSearch 92.7051%-116 - C1 -3BL6 MTNN_STAAM A:[2-230] MMIGIIGAMEEEV-T-ILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQ-----QQLTAK-VGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTV---EALVSQL-
11 PsiBlast_PDB 92.6152%-114 - C1 -4F3K ? A:[17-241] MKIGIIGAMEEEV-T-LLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRE-L----NLNAV-RGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS-TLM---VETL----
19 PsiBlast_PDB 92.5048%-117 - C1 -1Y6Q MTNN_ECOLI A:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
45 PsiBlast_CBE 92.3848%-117 - C1 -1Z5N MTNN_ECOLI A:[11-239] MKIGIIGAMEEQV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
82 HHSearch 92.3348%-115 * C1 *3EEI ? A:[4-233] KTVAVIGAMEQEI-E-LLREMMENVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVPQLPARFASDGILIEAAKRAART-F---EGAAVE-QGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAKMV---AEIVKSL-
40 PsiBlast_CBE 92.2548%-114 - C1 -1Y6Q MTNN_ECOLI B:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
9 PsiBlast_PDB 92.1852%-114 - C1 -4F2W ? A:[17-241] MKIGIIGAMEEEV-T-LLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRE-L----NLNAV-RGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS-TLM---VETL----
27 PsiBlast_CBE 92.0952%-114 - C1 -4F2W ? B:[17-241] MKIGIIGAMEEEV-T-LLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRE-L----NLNAV-RGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS-TLM---VETL----
37 PsiBlast_CBE 91.9848%-116 - C1 -3DF9 MTNN_ECO57 A:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
46 PsiBlast_CBE 91.9648%-116 - C1 -1Z5O MTNN_ECOLI B:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISNVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
15 PsiBlast_PDB 91.9148%-113 - C1 -4YML ? A:[1-229] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
25 PsiBlast_CBE 91.8252%-111 - C1 -4F3K ? B:[17-241] MKIGIIGAMEEEV-T-LLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRE-L----NLNAV-RGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS-TLM---VETL----
47 PsiBlast_CBE 91.7448%-115 - C1 -1Z5O MTNN_ECOLI A:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISNVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
13 PsiBlast_PDB 91.7348%-113 - C1 -3O4V MTNN_ECOLI A:[3-231] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
14 PsiBlast_PDB 91.7148%-112 - C1 -4WKC ? A:[1-229] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
6 PsiBlast_PDB 91.6848%-112 - C1 -4WKB ? A:[1-231] MKIGIIGAMQQEV-A-ILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQ-LPNT---HAV-RGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK---
1 PsiBlast_PDB 91.5849%-116 - C1 -3BL6 MTNN_STAAM A:[2-230] MMIGIIGAMEEEV-T-ILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQ-QQLTAK-----VGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTV---EALVSQL-
24 PsiBlast_CBE 91.5348%-111 - C1 -4WKB ? B:[1-231] MKIGIIGAMQQEV-A-ILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQ-LPNT---HAV-RGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK---
10 PsiBlast_PDB 91.4452%-112 - C1 -4F3C ? A:[17-241] MKIGIIGAMEEEV-T-LLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRE-L----NLNAV-RGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQS-TLM---VETL----
44 PsiBlast_CBE 91.3948%-115 - C1 -1Z5N MTNN_ECOLI B:[11-239] MKIGIIGAMEEQV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
53 PsiBlast_CBE 91.2546%-117 - C1 -3MMS ? A:[1-229] MKIGIIAAMPEEL-A-YLVQHLDNAQEQVVLGNTYHTGTIVSHEVVLVESGIGKVMSAMSVAILAVHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQ----IQE-SL----QNWH-LGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHALNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL---LAFLKAL-
17 PsiBlast_PDB 91.1748%-116 - C1 -1NC3 MTNN_ECOLI A:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKAD----DKLIAAAEA-CIAELNLNAV-RGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV---ESLVQKL-
18 PsiBlast_PDB 91.1448%-115 - C1 -1NC1 MTNN_ECOLI A:[11-239] MKIGIIGAMEEEV-T-LLRDKIENRQTISLGGCEIYTG