@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1631: (2016-03-27 )
MEILLQKVYDQENLSKEEMNIIATEIFEGRLSKTKMAAFLMALKVKGETAEEMAGIAQAMQQVAIQVAFPAGTAMDNCGTGGDKSNSFNISTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQELGIDINLRPEDMTYLLEKVGIAFLFAPHVHPNMKYVMDVRKELGTPTIFNLIGPLTNPVHLETQLMGIYRRDLLEQTAEVLGQLGRKRAVVLNGAGFMDEASLAGENHYALYENGEVHLYTLRPEDVGLTSYPLEAITGGDAKENAAILRSVLEGEPGAYLDTVLLNAGFGLFANGKVETVQEGVDLAKDLISSGLAKQKLADLITYQKEVLAK

Atome Classification :

(40 SA) -.........10........20........30........40........50........60........70-...----......80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270........280-........290.......300..--.-------....310.......320.......330.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MEILLQKVYDQENLSKEEMNIIATEIFEGRLSKTKMAAFLMALKVKGETAEEMAGIAQAMQQVAIQVAFP--AGT----AMDNCGTGGDKSNSFNISTTSAFVLAAAGIPVAKHGNRSISSRSGSADVCQELGIDINLRPEDMTYLLEKVGIAFLFAPHVHPNMKYVMDVRKELGTPTIFNLIGPLTNPVHLETQLMGIYRRDLLEQTAEVLGQLGRKRAVVLNGAGFMDEASLAGENHYALYENGEVHLYTLRPEDVGLTSYPLEAITGGDAKENA-AILRSVLEG-E-PGAYLDTVLLNAGFGLFANGKVE--T-------VQEGVDLAKDLISSGLAKQKLADLITYQKEVLAK
82 HHSearch 96.4041% -91 - C13 -1VQU TRPD2_NOSS1 A:[27-374] -WYLLLQQLIDGESLSRSQAAELMQGWLSEAVPPELSGAILTALNFKGVSADELTGMAEVLQSQSKM---TNSPFS----IIDTCGTG---SSTFNISTAVAFVAAAYGVPVAKHGNR--SSLTGSADVLEALGVNLGASPEKVQAALQEVGITFLFAPGWHPALKAVATLRRTLRIRTVFNLLGPLVNPLRPTGQVVGLFTPKLLTTVAQALDNLGKQKAIVLHGRERLDEAGLGDLTDLAVLSDGELQLTTINPQEVGVTPAPIGALRGGDVQENA-EILKAVLQG-KGTQAQQDAVALNAALALQVAGAVPLLD-------HAQGVSVAKEILQTGTAWAKLAQLVYFLGN----
84 HHSearch 96.2941% -98 * C13 *2ELC TRPD_THET8 A:[2-328] ---DAVKKAILGEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRVH--RRP----LLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYVLGVFSPEWLAPMAEALERLGA-RGLVVHG-EGADELVL-GENRVVEVGKG---AYALTPEEVGLKRAPLEALKGGGPEENA-ALARRLLKG-EEKGPLADAVALAAGAGFYAAGKTP--S-------LKEGVALAREVLASGEAYLLLERYVAFLR-----
12 PsiBlast_PDB 94.9636% -92 - C13 -4N8Q TRPD_MYCTU A:[30-370] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAAS-LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
67 PsiBlast_CBE 94.2636% -91 - C13 -3QR9 TRPD_MYCTU B:[29-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTG--GVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
47 PsiBlast_CBE 94.1636% -92 - C13 -4OWM TRPD_MYCTU B:[30-371] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAA--LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQIL--
60 PsiBlast_CBE 94.1136% -91 - C13 -3R6C TRPD_MYCTU A:[29-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
69 PsiBlast_CBE 94.0036% -93 - C13 -3QQS TRPD_MYCTU C:[29-367] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAAS-LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGR-----
16 PsiBlast_PDB 93.8836% -89 - C13 -4GIU TRPD_MYCTU A:[30-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQ----
56 PsiBlast_CBE 93.7536% -92 - C13 -3TWP TRPD_MYCTU A:[29-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
19 PsiBlast_PDB 93.7536% -92 - C13 -4OWQ TRPD_MYCTU A:[30-370] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
35 PsiBlast_CBE 93.7036% -92 - C13 -2BPQ TRPD_MYCTU B:[30-372] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGG-GVNTVNLSTMAAIVVAAAGVPVVKHGNRAA----GGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPS----AAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SAEWLPA-WEEGLRRASAAIDTGAAEQLLARWVRFGRQILA-
59 PsiBlast_CBE 93.6536% -90 - C13 -3R6C TRPD_MYCTU B:[29-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
42 PsiBlast_CBE 93.6536% -90 - C13 -4OWV TRPD_MYCTU B:[30-370] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTG--GVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
52 PsiBlast_CBE 93.6136% -94 - C13 -3UU1 TRPD_MYCTU C:[29-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAAS---GGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGL----EWLPA--WEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
61 PsiBlast_CBE 93.6036% -91 - C13 -3QSA TRPD_MYCTU B:[29-370] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQIL--
72 Fugue 93.5738% -98 - C13 -1KHD - ? A:[12-344] THQPILEKLFKSQSMTQEESHQLFAAIVRGELEDSQLAAALISMKMRGERPEEIAGAASALLADAQPFPRP--DYD----FADIVGTGGDGTNSINISTASAFVAASCGAKVAKHGNR--------CDLLQAFGIRLDMSAEDSRQALDDLNVCFLFAPQYHTGFRHAMPVRQQLKTRTIFNVLGPLINPARPPKALIGVYSPELVLPIAQALKVLGYKNAAVVHGGG-MDEVAIHTPTQVAELNNGEIESYQLSPQDFGLQSYSLNALQGGTPEENR-DILARLLQG-KGDAAHARQVAANVALLLKLFGQ-D--N-------LRHNAQLALETIRSGTAFERVTALAAR-------
70 PsiBlast_CBE 93.5736% -91 - C13 -3QQS TRPD_MYCTU B:[29-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
18 PsiBlast_PDB 93.5736% -92 - C13 -4OWO TRPD_MYCTU A:[30-370] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
49 PsiBlast_CBE 93.5436% -92 - C13 -4M0R TRPD_MYCTO A:[31-370] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTG---VNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQ----
37 PsiBlast_CBE 93.5036% -96 - C13 -4N8Q TRPD_MYCTU B:[30-372] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGG----TVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQILA-
62 PsiBlast_CBE 93.3936% -89 - C13 -3QSA TRPD_MYCTU A:[29-369] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANA-AAVRAVLGG-A-RGPVRDAVVLNAAGAIVAHAGLS--SRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI---
46 PsiBlast_CBE 93.2136% -92 - C13 -4OWN TRPD_MYCTU B:[30-371] ----ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LP--ADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAAS-LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAAR-RSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQ