@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1758: (2016-03-28 )
MADKKRYEELINILDQYSYDYYVIDNPTVEDAEYDQKMQELLKIEEAHPEWVTPESPSKRVGGEVLEGFKKVAHDTPMLSLANAFNHEDLADFDRRIRDKVGDDIAYMCELKIDGLAVSLQYENGKYKQGATRGDGTIGEDITANLRTIRSIPMKLQKDYSIEVRGEAFMPKRSFQKLNEIREEEGQMLFANPRNAAAGSLRQLDTKIAASRNLDIFLYAVADFGEMGVETHSAGLDMLETLGLKVNKERRLCSSLEEVYAYIDEWTEKRADLAYDIDGIVLKLNNLEQQRQMGTTVKSPRWSIAYKFPAEEVPTKLLDIELNVGRTGVITPTAVLEPVRVAGTTVSRASLHNEDLITEKDIRIGDTVLIKKAGDIIPEVIKSITEERSGSEEPFHMPKKCPTCDSELVRLEEEVALRCINPKCPAQIKEGLIHFVSRNAMNIDGLGEKVIIQLFSQHLIKDVADLFFLSKEKLLELERMGEKSVTNLLASIEASKQNSLEKLLFGLGIRHVGAKAAKSLAVHFETMDNLKVADKETLTSINDIGEKMADSIVTYFANEEVHDLLEELKRAGVNMTYTGPKLEDMSEEELVFAGKTVVLTGKLEKLTRNDAKALIESLGGNVSGSVSKKTDVVVAGSDAGSKLAKAEELAIPIWSEEDLIEYLPDEGGLNE

Atome Classification :

(33 SA) ---...-......10........20........30........40........50........60...-.-..-..70........80........90........100-.---..---.--.....110.......120.......130.......140.......150.....------.---.---160---.----.......170.......180.......190.......200.......210.......220---..-.---..-..230-.-........240......--.250-.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420..-......430.......440.......450.......460.......470.......480.......490.......500.......510.......520.......530.......540.......550.......560.......570.......580.......590.......600.......610.......620.......630.......640.......650.......660.......670
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---MAD-KKRYEELINILDQYSYDYYVIDNPTVEDAEYDQKMQELLKIEEAHPEWVTPESPSKRVGGE-V-LE-GFKKVAHDTPMLSLANAFNHEDLADFDRRIRDK---V---GD---D--IAYMCELKIDGLAVSLQYENGKYKQGATRGDGTIGEDITANLRTIRSIPMKLQ------K---D---Y-S---I----EVRGEAFMPKRSFQKLNEIREEEGQMLFANPRNAAAGSLRQLDTKIAASRNLDIFLYAVA---DF-G---EM-GVE---T-HSAGLDMLETLGLKVNK--ERRL-CSSLEEVYAYIDEWTEKRADLAYDIDGIVLKLNNLEQQRQMGTTVKSPRWSIAYKFPAEEVPTKLLDIELNVGRTGVITPTAVLEPVRVAGTTVSRASLHNEDLITEKDIRIGDTVLIKKAGDIIPEVIKSITEERSGSEEPFHMPKKCPTCDSELVRLEEEVALRCIN-PK-CPAQIKEGLIHFVSRNAMNIDGLGEKVIIQLFSQHLIKDVADLFFLSKEKLLELERMGEKSVTNLLASIEASKQNSLEKLLFGLGIRHVGAKAAKSLAVHFETMDNLKVADKETLTSINDIGEKMADSIVTYFANEEVHDLLEELKRAGVNMTYTGPKLEDMSEEELVFAGKTVVLTGKLEKLTRNDAKALIESLGGNVSGSVSKKTDVVVAGSDAGSKLAKAEELAIPIWSEEDLIEYLPDEGGLNE
1 PsiBlast_PDB 92.1546% -73 - C4 -2OWO DNLJ_ECOLI A:[5-586] -------EQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVGAA-P-LA-AFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDR---L---KN---NEKVTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLH------G---ENIPA-R---L----EVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVL-EG-G---EL-P-D---T-HLGRLLQFKKWGLPVSD--RVTL-CESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGEAVARCTG-GLICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALEAASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVH--WPAP-------------------------------------------------------------------------------------------
34 HHSearch 91.9746% -72 - C4 -2OWO DNLJ_ECOLI A:[2-586] ---ESI-EQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVGAA-P-LA-AFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDR---L---KNNE-K--VTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGEN---I---P---A-R---L----EVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVG---VL-E---GGELPD---T-HLGRLLQFKKWGLPVSD--RVTL-CESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGEAVARCTGGLI-CGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALEAASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVHWPAP---------------------------------------------------------------------------------------------
2 PsiBlast_PDB 89.0845% -76 - C4 -4GLX DNLJ_ECOLI A:[5-582] -------EQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQR-----P-LA-AFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDR----------------TWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLH------G---ENIPA-R---L----EVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVL-EG-G---EL-P-D---T-HLGRLLQFKKWGLPVSD--RVTL-CESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGEAVARCTG-GLICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALEAASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVH-------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 87.2345% -68 - C4 -1V9P DNLJ_THEFI A:[7-581] -------RRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGAR-P-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERA---L---GR---KRPFLYTVEHKVDGLSVNLYYEEGVLVFGATRGDGEVGEEVTQNLLTIPTIPRRLK------GV--P---D-R---L----EVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGL--GL-E---ES-GLK---S-QYELLLWLKEKGFPVEHGYEKALGAEGVEEVY---RRFLAQRHALPFEADGVVVKLDDLALWRELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGEERPIRWPETCPECGHRLVK--EGKVHRCPN-PL-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELLEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSM------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 86.9545% -65 - C4 -1V9P DNLJ_THEFI B:[7-581] -------RRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGAR-P-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERA---L---GR---KRPFLYTVEHKVDGLSVNLYYEEGVLVFGATRGDGEVGEEVTQNLLTIPTIPRRLK------GV--P---D-R---L----EVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGL--GL-E---ES-GLK---S-QYELLLWLKEKGFPVEHGYEKALGAEGVEEVY---RRFLAQRHALPFEADGVVVKLDDLALWRELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGEERPIRWPETCPECGHRLVK--EGKVHRCPN-PL-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELLEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSM------------------------------------------------------------------------------------------------
56 Fugue 86.6544% -64 - C4 -1DGS DNLJ_THEFI A:[1-581] MTREEA-RRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGAR-P-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERE---A---EA---P--SLYTVEHKVDGLSV-LYYEEG--VWSTGSGDGEVGEEVTQNLLTIPTIPRRLK------G---V---PDR---L----EVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALG---LG-LGLEES-GLK---S-QYELLLWLKEKGFPVEH--CYEK-ALGAEGVEEVYRRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHRL--VKEGKVHRCPN-PL-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSMESK---------------------------------------------------------------------------------------------
21 PsiBlast_CBE 85.8443% -62 - C4 -1DGS DNLJ_THEFI B:[7-581] -------RRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGAR-P-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERE---A---EA---P--SLYTVEHKVDGLSV-LYYEEGVWSTGS--GDGEVGEEVTQNLLTIPTIPRRLK------GV--P---D-R---L----EVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGLGLGL-E---ES-GLK---S-QYELLLWLKEKGFPVEHCYEKALGAEGVEEVY---RRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHRLVK--EGKVHRCPN-PL-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSM-------ESK--------------------------------------------------------------------------------------
3 PsiBlast_PDB 85.0443% -62 - C4 -1DGS DNLJ_THEFI A:[7-581] -------RRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGAR-P-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERE---A---EA---P--SLYTVEHKVDGLSV-LYYEEGVWSTGS--GDGEVGEEVTQNLLTIPTIPRRLK------GV--P---D-R---L----EVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGLGLGL-E---ES-GLK---S-QYELLLWLKEKGFPVEHCYEKALGAEGVEEVY---RRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHRLVK--EGKVHRCPN-PL-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSM-------ESK--------------------------------------------------------------------------------------
13 PsiBlast_PDB 70.4058% -56 - C4 -4EEQ DNLJ_ENTFA A:[10-317] ----AA-TTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGK-V-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GK---P--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLT------E---P---I-S---V----EVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DF-G---PM-KAK---T-QFEALEELSAIGFRTNP--ERQL-CQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 70.2358% -59 - C4 -3BA8 DNLJ_ENTFA A:[10-317] ----AA-TTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGK-V-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GK---P--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLT------E---P---I-S---V----EVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DF-G---PM-KAK---T-QFEALEELSAIGFRTNP--ERQL-CQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 69.7558% -57 - C4 -4EFE DNLJ_ENTFA A:[10-317] ----AA-TTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGK-V-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GK---P--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLT------E---P---I-S---V----EVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DF-G---PM-KAK---T-QFEALEELSAIGFRTNP--ERQL-CQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 69.5458% -58 - C4 -4EFB DNLJ_ENTFA A:[10-317] ----AA-TTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGK-V-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GK---P--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLT------E---P---I-S---V----EVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DF-G---PM-KAK---T-QFEALEELSAIGFRTNP--ERQL-CQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 69.4458% -58 - C4 -3BA9 DNLJ_ENTFA A:[10-317] ----AA-TTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGK-V-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GK---P--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLT------E---P---I-S---V----EVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DF-G---PM-KAK---T-QFEALEELSAIGFRTNP--ERQL-CQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 69.1258% -54 - C4 -1TA8 DNLJ_ENTFA A:[10-317] ----AA-TTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGK-V-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GK---P--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLT------E---P---I-S---V----EVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DF-G---PM-KAK---T-QFEALEELSAIGFRTNP--ERQL-CQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 68.7758% -56 - C4 -3BAA DNLJ_ENTFA A:[10-317] ----AA-TTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGK-V-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GK---P--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLT------E---P---I-S---V----EVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DF-G---PM-KAK---T-QFEALEELSAIGFRTNP--ERQL-CQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------