@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1856: (2016-03-29 )
MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK

Atome Classification :

(53 SA) .........10........20........30...-.....40........50........60........70........80........90........100.......110.......120--.......130.......140.......150.......160....-...170........180.......190.......200.......210.......220.......230.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLE-DVVLFNQVRGMLGFTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRNTFAG--VDFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLDK-QQLAD-YGVLGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK
22 PsiBlast_CBE 96.2175%-119 - C1 -1XE3 DEOD_BACAN F:[15-243] ----IEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAI-
31 PsiBlast_CBE 96.0770%-119 - C1 -4D8Y DEOD_BACSU F:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
25 PsiBlast_CBE 95.8675%-117 - C1 -1XE3 DEOD_BACAN C:[15-243] ----IEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAI-
4 PsiBlast_PDB 95.8675%-115 - C1 -3UAZ DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSNHIFTGEETTSEERQTTFNEMIEIALDAAIQ
3 PsiBlast_PDB 95.8475%-116 - C1 -3UAY DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSNHIFTGEETTSEERQTTFNEMIEIALDAAIQ
23 PsiBlast_CBE 95.8375%-115 - C1 -1XE3 DEOD_BACAN E:[15-244] ----IEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQ
2 PsiBlast_PDB 95.3575%-113 - C1 -3UAW DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQ
34 PsiBlast_CBE 95.2770%-120 - C1 -4D8Y DEOD_BACSU C:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
35 PsiBlast_CBE 95.2270%-120 - C1 -4D8Y DEOD_BACSU B:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
5 PsiBlast_PDB 95.0775%-116 - C1 -1XE3 DEOD_BACAN A:[15-242] ----IEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAA--
24 PsiBlast_CBE 94.7975%-115 - C1 -1XE3 DEOD_BACAN D:[15-244] ----IEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQ
32 PsiBlast_CBE 94.5470%-121 - C1 -4D8Y DEOD_BACSU E:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
33 PsiBlast_CBE 94.3870%-118 - C1 -4D8Y DEOD_BACSU D:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
12 PsiBlast_PDB 94.3670%-117 - C1 -4DA6 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
26 PsiBlast_CBE 94.2675%-118 - C1 -1XE3 DEOD_BACAN B:[15-243] ----IEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAI-
18 PsiBlast_PDB 94.1270%-120 - C1 -4DAO DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
10 PsiBlast_PDB 94.1270%-119 - C1 -4D9H DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
19 PsiBlast_PDB 94.0770%-119 - C1 -4DAR DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
17 PsiBlast_PDB 93.6970%-118 - C1 -4DAN DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
15 PsiBlast_PDB 93.5570%-117 - C1 -4DAB DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
13 PsiBlast_PDB 93.2970%-117 - C1 -4DA7 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
16 PsiBlast_PDB 93.0370%-117 - C1 -4DAE DEOD_BACSU A:[21-250] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
36 PsiBlast_CBE 92.9870%-115 - C1 -4D8V DEOD_BACSU B:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
28 PsiBlast_CBE 92.8170%-119 - C1 -4DAN DEOD_BACSU B:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
121 HHSearch 92.8075%-109 - C1 -3UAW DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAE-TFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQ
14 PsiBlast_PDB 92.4470%-117 - C1 -4DA8 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
21 PsiBlast_CBE 91.8975%-123 - C1 -2AC7 DEOD_BACAN B:[2-232] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLE-DVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPG--FDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGD-YGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIF----------QTTFNEMIEIALDAA--
6 PsiBlast_PDB 91.7870%-114 - C1 -4D8V DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
27 PsiBlast_CBE 91.4870%-116 - C1 -4DAO DEOD_BACSU B:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
11 PsiBlast_PDB 90.4870%-116 - C1 -4DA0 DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLE-NVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQI-EKLAK-YGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS---
101 PsiBlast_CBE 87.1757%-113 - C1 -1PW7 DEOD_ECO57 B:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLE-DAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKD--HDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEK-YGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL-
104 PsiBlast_CBE 87.0357%-115 - C1 -1PR6 DEOD_ECO57 B:[5-234] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLE-DAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKD--HDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEK-YGILGVEMEAAGIYGVAAEFGAKALTICTVSDHI----QTTAAERQTTFNDMIKIALESVL-
89 PsiBlast_CBE 86.3257%-110 - C1 -1PK9 DEOD_ECO57 B:[4-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLE-DAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKD--HDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEM-FDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL-
102 PsiBlast