@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1927: (2016-03-30 )
MPEITVRAKSKTYPVYINEFALEDIREKWTKSLAKFSHVFVLTDGHVAELHKAKLDAVLADLPVVTYYVAPNGEEAKTFRVYEDVMTKMIETGLDRKAVLIAFGGGVIGDLGGFVAATYMRGIPFYQVPTTVLAHDSAVGGKVAINHPLGKNMIGNFYQPEAVIYDTQFFATLPERELRSGFAEMIKHALISDLTLLRALMDTFTEPKDFYTKDLTPFLQRGIEIKANIVAQDETEQGVRAYLNFGHTFGHALEAYGNFGKWLHGEAITYGMIYALTMSETIYGLDFDLAEFKTWLEQLGYDTTFDASVPFSKILENMRHDKKTTFNEISMVLLEEIGKPVIFKADDDLIFETYKRVMRKGGNVI

Atome Classification :

(39 SA) .........10........20..--......30........40........50....-....60-..-------.------...--..70.........80........90..--......100.......110.......120.......130..-.-....140.......150.......160.......170.......180.......190.......200....-...--------------210------...-.....220-....------------....230.......240.......250.......260.......270.......280-----------------...-..-..290-..---......300---------......-..---------310.......320..-----..-----...330.......340..-----.-.....350.......360...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MPEITVRAKSKTYPVYINEFALE--DIREKWTKSLAKFSHVFVLTDGHVAELHKAKL-DAVLAD-LP-------V------VTY--YVA-PNGEEAKTFRVYEDVMTKMIETG--LDRKAVLIAFGGGVIGDLGGFVAATYMRGIPFYQVPTTVLA-H-DSAVGGKVAINHPLGKNMIGNFYQPEAVIYDTQFFATLPERELRSGFAEMIKHALISDLTLLRALMDTFTE-PKD--------------FY-------TKD-LTPFLQR--GIEI------------KANIVAQDETEQGVRAYLNFGHTFGHALEAYGNFGKWLHGEAITYGMIYALTMSETI-----------------YGL-DF-DLA-E-FK---TWLEQLGY----------DTTFDA-SV---------PFSKILENMRHDKKT-----TF-----NEISMVLLEEIGKP-VIF-----K-ADDDLIFETYKRVMRKGGNVI
22 PsiBlast_CBE 91.3638%-114 - C5 -1XAI AROB_STAAR B:[9-338] ---------SNNYPIYVEHGAIK--YI----GTYLNQFDQSFLLIDEYVNQYFANKF-DDILS--YE-------N------VHK--VII-PAGEKTKTFEQYQETLEYILSHH--VTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILA-H-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKD-REI--------------LQ-------SLNGMDKYIAK--GIET------------KLDIVVADEKEQGVRKFLNLGHTFGHAVEYY---HKIPHGHAVMVGIIYQFIVANAL-----------------FDS-KH-DIS-H-YI---QYLIQLGY----------PLDMIT-DL---------DFETLYQYMLSDKKN-----DK-----QGVQMVLMRQFGDI-VVQ-----H-VD-------------------
2 PsiBlast_PDB 91.1238%-113 - C5 -1XAG AROB_STAAR A:[9-338] ---------SNNYPIYVEHGAIK--YI----GTYLNQFDQSFLLIDEYVNQYFANKF-DDILS--YE-------N------VHK--VII-PAGEKTKTFEQYQETLEYILSHH--VTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILA-H-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKD-REI--------------LQ-------SLNGMDKYIAK--GIET------------KLDIVVADEKEQGVRKFLNLGHTFGHAVEYY---HKIPHGHAVMVGIIYQFIVANAL-----------------FDS-KH-DIS-H-YI---QYLIQLGY----------PLDMIT-DL---------DFETLYQYMLSDKKN-----DK-----QGVQMVLMRQFGDI-VVQ-----H-VD-------------------
1 PsiBlast_PDB 90.5739%-109 - C5 -3OKF AROB_VIBCH A:[30-373] MERITVNLGERSYPISIGAGLFA--N---PALLSLSAKQKVVIVTNHTVAPLYAPAI-ISLLDH-IG-------C------QHA--LLELPDGEQYKTLETFNTVMSFLLEHN--YSRDVVVIALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLS-QVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDSAFFDWLEAQMEA-LYA--------------LD-------EQA-LTYAIAR--CCQI------------KAEVVAQDEK--GIRALLNLGHTFGHAIEAHMGYGNWLHGEAVSAGTVMAAKTAQ-L-----------------QGL--I-DAS-Q-FERILAILKKAHL----------PVRTPE-NM---------TFADFMQHMMRDKKV-----LA-----GELRLVLPTSIGTS-AVV-----K----------------------
45 HHSearch 90.2533%-110 * C5 *3QBE AROB_MYCTU A:[19-367] -------AVDPPYPVVIGTGLLD--ELEDLLA----DRHKVAVVHQPGLAE-TAEEI-RKRLAGKGV-------D------AHR--IEI-PDAEAGKDLPVVGFIWEVLGRIG--IGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMV-DAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVILDLIEADPQA-ALD--------------PA-------GDV-LPELIRR--AITV------------KAEVVAA----SELREILNYGHTLGHAIERRERY-RWRHGAAVSVGLVFAAELARLA-----------------GRL-DDATAQ-R-HR---TILSSLGL----------PVSYDP--D---------ALPQLLEIMAGDKKT-----RA-----GVLRFVVLDGLAKP-GRM-----VGPDPGLLVTAYAGVCA------
4 PsiBlast_PDB 90.1938%-114 - C5 -1XAI AROB_STAAR A:[9-338] ---------SNNYPIYVEHGAIK--YI----GTYLNQFDQSFLLIDEYVNQYFANKF-DDILS--YE-------N------VHK--VII-PAGEKTKTFEQYQETLEYILSHH--VTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILA-H-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKD-REI--------------LQ-------SLNGMDKYIAK--GIET------------KLDIVVADEKEQGVRKFLNLGHTFGHAVEYY---HKIPHGHAVMVGIIYQFIVANAL-----------------FDS-KH-DIS-H-YI---QYLIQLGY----------PLDMIT-DL---------DFETLYQYMLSDKKN-----DK-----QGVQMVLMRQFGDI-VVQ-----H-VD-------------------
40 HHSearch 90.1238%-108 - C5 -3OKF AROB_VIBCH A:[30-389] MERITVNLGERSYPISIGAGLFA--N-PALLSLS--AKQKVVIVTNHTVAPLYAPAI-ISLLDHIGC-------Q------HAL--LEL-PDGEQYKTLETFNTVMSFLLEHN--YSRDVVVIALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLSQV-DSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDSAFFDWLEAQMEA-LYA--------------LD-------EQA-LTYAIAR--CCQI------------KAEVVAQDEK--GIRALLNLGHTFGHAIEAHMGYGNWLHGEAVSAGTVMAAKTAQLQ-----------------GLI-DASQFE-R-IL---AILKKAHL----------PVRTPE-NM---------TFADFMQHMMRDKKV-----LA-----GELRLVLPTSIGTS-AVV-----KGVPEAVIAQAIEYCRT------
3 PsiBlast_PDB 90.0538%-119 - C5 -1XAH AROB_STAAR A:[9-338] ---------SNNYPIYVEHGAIK--YI----GTYLNQFDQSFLLIDEYVNQYFANKF-D---------------N------VHK--VII-PAGEKTKTFEQYQETLEYILSHH--VTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILA-H-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKD-REI--------------LQ-------SLNGMDKYIAK--GIET------------KLDIVVADEKEQGVRKFLNLGHTFGHAVEYY---HKIPHGHAVMVGIIYQFIVANAL-----------------FDS-KH-DIS-H-YI---QYLIQLGY----------PLD-------------------------------------------GVQMVLMRQFGDI-VVQ-----H-VD-------------------
21 PsiBlast_CBE 88.8339%-112 - C5 -3OKF AROB_VIBCH B:[30-373] MERITVNLGERSYPISIGAGLFA--N---PALLSLSAKQKVVIVTNHTVAPLYAPAI-ISLLDH-IG-------C------QHA--LLELPDGEQYKTLETFNTVMSFLLEHN--YSRDVVVIALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLS-QVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDSAFFDWLEAQMEA-LYA--------------LD-------EQA-LTYAIAR--CCQI------------KAEVVAQDEKESGIRALLNLGHTFGHAIEAHMGYGNWLHGEAVSAGTVMAAKTAQ-L-----------------QGL--I-DAS-Q-FERILAILKKAHL----------PVRTPE-NM---------TFADFMQHMMR--------------------LVLPTSIGTS-AVV-----K----------------------
41 HHSearch 87.5337%-106 - C5 -1XAH AROB_STAAR A:[1-351] -MKLQTTYPSNNYPIYVEHGAIK--YIGTYLNQF----DQSFLLIDEYVNQYFANKF-D------NV-------H--------K--VII-PAGEKTKTFEQYQETLEYILSHH--VTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILA-H-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREIL--------------QS-------LNG-MDKYIAK--GIET------------KLDIVVADEKEQGVRKFLNLGHTFGHAVEYYH---KIPHGHAVMVGIIYQFIVANAL-----------------F-D-SKHDIS-H-YI---QYLIQLGY----------PLD-------------------------------------------GVQMVLMRQFGDI-VVQ-----H-VDQLTLQHACEQLKT------
44 HHSearch 84.5432%-103 - C5 -1SG6 ARO1_EMENI A:[10-392] ---------LGRESIIADFGLWRNYVAKDLISDC--SSTTYVLVTDTNIGSIYTPSF-EEAFRKRAA-------EITPSPRLLI--YNR-PPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMV-DSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAET-ILKAVRREVTPGEHRFEGT-------EEI-LKARILA--SARH------------KAYVVSA-----GLRNLLNWGHSIGHAIEAILTP-QILHGECVAIGMVKEAELARHL-----------------GIL-KGVAVS-R-IV---KCLAAYGL----------PTSLKDARIRKLTAGKHCSVDQLMFNMALDKK-----------------IVLLSAIGTP-YETRA---SVVANEDIRVVLA----------
62 Fugue 83.2432% -97 - C5 -1DQS ARO1_EMENI A:[4-391] PTKISIL---GRESIIADFGLWR--NYVAKDLISDCSSTTYVLVTDTNIGSIYTPSF-EEAFRK-RAAEITPSPR------LLI--YNR-PPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLA-MVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAET-ILK--------------AVRRRFEGTEEI-LKARILA--SARH------------KAYVVSADEREGGLRNLLNWGHSIGHAIEAILTP-QILHGECVAIGMVKEAELARHL-----------------GILKGV-AVS-R-IV---KCLAAYGLPTSLKDARIRKLTAGK-HC---------SVDQLMFNMALDKKN-----DG-----PKKKIVLLSAIGTP-YET-----R-ASV-VANEDIRVVL-------
25 PsiBlast_CBE 81.1836% -98 - C5 -3ZOK DHQS_ACTCH B:[17-364] ---VDVDLGDRSYPIYIGSGLLDQPDLLQRHVHG----KRVLVVTNSTVAPIYLDKVVGALTNE-NP-------N------VSVESVIL-PDGEKYKNMDTLMKVFDKAIESR--LDRRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMA-QVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEKNMPA-LMA--------------RD-------PSA-LAYAIKR--SCEN------------KAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRL-----------------GWI-DE-SIVNR-AH---NILQQAKL----------PTAPPE-TM---------TVEMFKSVMAVDKKV-----AD-----GLLRLILLKGPLGN-CVF-----T-GDYD-----------------
24 PsiBlast_CBE 80.9036% -99 - C5 -3ZOK DHQS_ACTCH C:[17-364] ---VDVDLGDRSYPIYIGSGLLDQPDLLQRHVHG----KRVLVVTNSTVAPIYLDKVVGALTNE-NP-------N------VSVESVIL-PDGEKYKNMDTLMKVFDKAIESR--LDRRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMA-QVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEKNMPA-LMA--------------RD-------PSA-LAYAIKR--SCEN------------KAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRL-----------------GWI-DE-SIVNR-AH---NILQQAKL----------PTAPPE-TM---------TVEMFKSVMAVDKKV-----AD-----GLLRLILLKGPLGN-CVF-----T-GDYD-----------------
5 PsiBlast_PDB 80.4236% -97 - C5 -3ZOK DHQS_ACTCH A:[17-364] ---VDVDLGDRSYPIYIGSGLLDQPDLLQRHVHG----KRVLVVTNSTVAPIYLDKVVGALTNE-NP-------N------VSVESVIL-PDGEKYKNMDTLMKVFDKAIESR--LDRRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMA-QVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEKNMPA-LMA--------------RD-------PSA-LAYAIKR--SCEN------------KAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRL-----------------GWI-DE-SIVNR-AH---NILQQAKL----------PTAPPE-TM---------TVEMFKSVMAVDKKV-----AD-----GLLRLILLKGPLGN-CVF-----T-GDYD-----------------
23 PsiBlast_CBE 79.9036%-100 - C5 -3ZOK DHQS_ACTCH D:[17-364] ---VDVDLGDRSYPIYIGSGLLDQPDLLQRHVHG----KRVLVVTNSTVAPIYLDKVVGALTNE-NP-------N------VSVESVIL-PDGEKYKNMDTLMKVFDKAIESR--LDRRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMA-QVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEKNMPA-LMA--------------RD-------PSA-LAYAIKR--SCEN------------KAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRL-----------------GWI-DE-SIVNR-AH---NILQQAKL----------PTAPPE-TM---------TVEMFKSVMAVDKKV-----AD-----GLLRLILLKGPLGN-CVF-----T-GDYD-----------------