@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo1953: (2016-03-30 )
MSLEKVNEAVAKIRESYTGTPKIGLILGSGLGVLADEVNQPIKLSYSEIPHFPVSTVEGHAGQFVFGELENKEVVAMQGRFHFYEGYSMQDVTFPVRVMKELGVEVLIVTNAAGGVNELYSAGDLMLISDHINFTGTSPLIGPNDEHFGPRFPDMSEAYNLALRVDARLIAQELNLTIREGVYAGFSGPTYETPAEIQMMRTLGADAVGMSTVPEVIIANHAGLRVLGISCITNMAAGILDQPLSHTEVIETTDQVRSTFLQYVKAIVAKIS

Atome Classification :

(80 SA) .........10.......--.20........30........40.........50........60........70........80........90...---.....100.......110.......120.......130.---...---.---..140.......150.......160.......170.--.--..--.--..180.......190.......200.......210.......220.......230.......240---.----..--.....250.......260.......270
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSLEKVNEAVAKIRESYT--GTPKIGLILGSGLGVLADEVNQ-PIKLSYSEIPHFPVSTVEGHAGQFVFGELENKEVVAMQGRFHFYEGYSMQDVTF---PVRVMKELGVEVLIVTNAAGGVNELYSAGDLMLISDHIN---FTG---T---SPLIGPNDEHFGPRFPDMSEAYNLALRVDARLIAQE--L--NL--T--IREGVYAGFSGPTYETPAEIQMMRTLGADAVGMSTVPEVIIANHAGLRVLGISCITNMAAGILD----Q----PL--SHTEVIETTDQVRSTFLQYVKAIVAKIS
2 PsiBlast_PDB 94.9853%-122 - C4 -3LBA ? A:[38-303] --LKKIYETRDFLTAKGV--QKPEFGLILGSGLGELAEEIEN-ALVLNYADIPNWGRS------GKLIYGELAGRKVLALQGRFHYYEGNSMELVTF---PIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LTG---A---NPLMGENLDDFGFRFPDMSNAYTADYREVAHQVADK--I--GI--K--LDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGFQS----E-----L--N---VVAVTQQIKEDFKGLVKAILVEL-
111 HHSearch 92.9049%-112 * C4 *3FUC PNPH_BOVIN A:[5-283] YTYEDYQDTAKWLLS-HTE-QRPQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHIN---LPG---FSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--M--GEQRE--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQ--G----KA--NHEEVLEAGKQAAQKLEQFVSLLMASIP
39 PsiBlast_CBE 92.5850%-114 - C4 -3PHB PNPH_HUMAN E:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
110 HHSearch 92.5354%-127 - C4 -3LA8 ? A:[36-303] SLLKKIYETRDFLTAKGV--QKPEFGLILGSGLGELAEEIEN-ALVLNYADIPNWG---------KLIYGELAGRKVLALQ-RFHYYEG-SMELVTF---PIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LTG---A---NPLMG-NLDDFGFRFPDMSNAYTADYREVAHQVADK--I--GI--K--LDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGF--------------------VAVTQQIKEDFKGLVKAILVEL-
1 PsiBlast_PDB 92.3653%-129 - C4 -3LA8 ? A:[38-303] --LKKIYETRDFLTAKGV--QKPEFGLILGSGLGELAEEIEN-ALVLNYADIPNWG---------KLIYGELAGRKVLALQ-RFHYYEG-SMELVTF---PIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LTG---A---NPLMG-NLDDFGFRFPDMSNAYTADYREVAHQVADK--I--GI--K--LDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGF--------------------VAVTQQIKEDFKGLVKAILVEL-
82 PsiBlast_CBE 92.3050%-112 - C4 -4EB8 PNPH_HUMAN B:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NWEEVLAAGKQAAQKLEQFVSILMASI-
53 PsiBlast_CBE 92.0650%-115 - C4 -3K8O PNPH_HUMAN S:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
79 PsiBlast_CBE 91.9950%-116 - C4 -4ECE PNPH_HUMAN B:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NWEEVLAAGKQAAQKLEQFVSILMASI-
78 PsiBlast_CBE 91.9550%-114 - C4 -4ECE PNPH_HUMAN C:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NWEEVLAAGKQAAQKLEQFVSILMASI-
52 PsiBlast_CBE 91.8150%-113 - C4 -3K8O PNPH_HUMAN T:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
116 HHSearch 91.7944%-114 - C4 -3ODG ? A:[16-285] ---ELPFQAVKYIQK-IKPGFKPQIAFILGSGLGDLVDQITN-DTTISYADIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTN---PVRTFKLMGCEFLFCTNAAGSLRPEVLPGSVVMLKDHIN---TMP---G---TPLVGPNDDRFGPRFFSLANAYDKDLRADMAKIAQQ--L--DI--P--LTEGVFVSYPGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITNLAEGLSD----V----VL--SHEQTLKFAKVASVNFTKLIEAFLKSKA
50 PsiBlast_CBE 91.7750%-117 - C4 -3K8O PNPH_HUMAN Y:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
51 PsiBlast_CBE 91.5850%-119 - C4 -3K8O PNPH_HUMAN U:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
81 PsiBlast_CBE 91.5650%-112 - C4 -4EB8 PNPH_HUMAN C:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NWEEVLAAGKQAAQKLEQFVSILMASI-
73 PsiBlast_CBE 91.5650%-121 - C4 -4GKA PNPH_HUMAN D:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYE--------------------KQAAQKLEQFVSILMASI-
35 PsiBlast_CBE 91.5450%-115 - C4 -3PHB PNPH_HUMAN U:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
76 PsiBlast_CBE 91.5350%-115 - C4 -4ECE PNPH_HUMAN E:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NWEEVLAAGKQAAQKLEQFVSILMASI-
70 PsiBlast_CBE 91.5350%-115 - C4 -2A0Y PNPH_HUMAN A:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NDEEVLAAGKQAAQKLEQFVSILMASI-
55 PsiBlast_CBE 91.4650%-114 - C4 -3K8O PNPH_HUMAN E:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
77 PsiBlast_CBE 91.2150%-118 - C4 -4ECE PNPH_HUMAN D:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NWEEVLAAGKQAAQKLEQFVSILMASI-
18 PsiBlast_PDB 91.0651%-121 - C4 -2AI3 PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----Y----KA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
6 PsiBlast_PDB 90.8951%-114 - C4 -1A9T PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----TESQGKA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
16 PsiBlast_PDB 90.8651%-122 - C4 -2AI1 PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----YESQGKA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
20 PsiBlast_PDB 90.6751%-112 - C4 -1B8O PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----YESQGKA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
83 PsiBlast_CBE 90.4950%-110 - C4 -4EB8 PNPH_HUMAN A:[60-317] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NWEEVLAAGKQAAQKLEQFVSILMASI-
3 PsiBlast_PDB 90.3251%-115 - C4 -1FXU PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----TG---KA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
4 PsiBlast_PDB 90.3151%-115 - C4 -1A9Q PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----TESQGKA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
19 PsiBlast_PDB 90.2851%-114 - C4 -1B8N PNPH_BOVIN A:[25-279] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----YESQGKA--NHEEVLEAGKQAAQKLEQFVSLLM----
58 PsiBlast_CBE 90.2750%-115 - C4 -3BGS PNPH_HUMAN A:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NHEEVLAAGKQAAQKLEQFVSILMASI-
5 PsiBlast_PDB 90.0351%-116 - C4 -1A9R PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----TESQGKA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
68 PsiBlast_CBE 89.9550%-113 - C4 -2A0X PNPH_HUMAN A:[25-282] ----------------------PQVAIICGSGLGGLTDKLTQ-AQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTF---PVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSG---Q---NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ--MGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KA--NFEEVLAAGKQAAQKLEQFVSILMASI-
33 PsiBlast_CBE 89.9251%-120 - C4 -3FUC PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----YESQGKA--NHEEVLEAGKQAAQKLEQFVSLLMASI-
11 PsiBlast_PDB 89.9151%-113 - C4 -1A9S PNPH_BOVIN A:[25-282] ----------------------PQVAVICGSGLGGLVNKLTQ-AQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTF---PVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSG---E---NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ--MGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----TESQGKA--NHEEVLEAGKQAAQKLEQFVSLLMASI-