@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2032: (2016-03-31 )
MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG

Atome Classification :

(50 SA) ----.........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......--210.........220.......230.......240.......250........260.......270.......280.......290.......300-.-......310...-....320.......330.......340.......350.......360.......370.......380.......390
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINL--D--FADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLE-TSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDEL-K-DELIVTVIATGF-DEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG
62 HHSearch 97.4783%-109 - C3 -2VXY FTSZ_BACSU A:[11-316] --------------LASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-I---------------------------------------------------------------------------
32 PsiBlast_CBE 97.2481%-103 - C3 -3WGJ FTSZ_STAAM B:[4-307] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
14 PsiBlast_PDB 96.9381%-105 - C3 -3WGJ FTSZ_STAAM A:[4-307] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
16 PsiBlast_PDB 96.3481%-103 - C3 -3VOA FTSZ_STAAM A:[3-307] --------------MATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
17 PsiBlast_PDB 95.8681% -98 - C3 -3VOB FTSZ_STAAM A:[4-307] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
1 PsiBlast_PDB 95.7475%-112 - C3 -2VAM FTSZ_BACSU A:[12-315] ---------------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-----------------------------------------------------------------------------
2 PsiBlast_PDB 95.4975%-109 - C3 -2VXY FTSZ_BACSU A:[11-316] --------------LASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-I---------------------------------------------------------------------------
15 PsiBlast_PDB 95.4878% -97 - C3 -4M8I FTSZ_STAEQ A:[17-327] --------------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTAGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFGFEGRKRQTQAAAGVESMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-EDKPSS----------------------------------------------------------------------
28 PsiBlast_CBE 93.8269%-101 - C3 -3VO8 FTSZ_STAAM B:[14-317] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
10 PsiBlast_PDB 93.7669%-100 - C3 -4DXD FTSZ_STAAU A:[18-324] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-DDK-------------------------------------------------------------------------
4 PsiBlast_PDB 93.6886%-103 - C3 -2RHH FTSZ_BACSU A:[19-305] --------------------------------RMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-----------------------------------------------------------------------------
12 PsiBlast_PDB 93.5469%-102 - C3 -3WGM FTSZ_STAAM A:[14-314] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATG------------------------------------------------------------------------------
5 PsiBlast_PDB 93.4086%-104 - C3 -2RHJ FTSZ_BACSU A:[19-307] --------------------------------RMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-LE--------------------------------------------------------------------------
6 PsiBlast_PDB 93.1686%-107 - C3 -2RHL FTSZ_BACSU A:[19-306] --------------------------------RMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-L---------------------------------------------------------------------------
8 PsiBlast_PDB 93.1169%-100 - C3 -3VO8 FTSZ_STAAM A:[14-318] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-D---------------------------------------------------------------------------
31 PsiBlast_CBE 92.9369%-100 - C3 -3WGK FTSZ_STAAM B:[13-316] --------------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--GL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-D---------------------------------------------------------------------------
13 PsiBlast_PDB 92.9269%-103 - C3 -3WGK FTSZ_STAAM A:[13-316] --------------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--GL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-D---------------------------------------------------------------------------
30 PsiBlast_CBE 92.8369%-100 - C3 -3WGL FTSZ_STAAM B:[13-316] --------------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-D---------------------------------------------------------------------------
29 PsiBlast_CBE 92.7669%-100 - C3 -3WGM FTSZ_STAAM B:[14-314] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATG------------------------------------------------------------------------------
26 PsiBlast_CBE 92.7586%-100 - C3 -2RHL FTSZ_BACSU B:[19-307] --------------------------------RMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-LE--------------------------------------------------------------------------
9 PsiBlast_PDB 92.6469%-105 - C3 -3WGN FTSZ_STAAM A:[14-317] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
7 PsiBlast_PDB 92.5086%-104 - C3 -2RHO FTSZ_BACSU A:[19-306] --------------------------------RMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-L---------------------------------------------------------------------------
27 PsiBlast_CBE 92.2369%-104 - C3 -3WGN FTSZ_STAAM B:[14-317] ---------------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
11 PsiBlast_PDB 91.9969%-103 - C3 -3WGL FTSZ_STAAM A:[13-315] --------------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-----------------------------------------------------------------------------
25 PsiBlast_CBE 91.8586%-103 - C3 -2RHO FTSZ_BACSU B:[19-305] --------------------------------RMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSN--SALMGIGIATGENRAAEAAKKAISSPLLE-AAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-----------------------------------------------------------------------------
64 HHSearch 90.2761%-101 - C3 -1RQ2 FTSZ_MYCTU A:[11-315] --------------LAVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDST-----GADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
35 PsiBlast_CBE 89.5364%-106 - C3 -4KWE FTSZ_MYCTU A:[25-315] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDSTRGLGAGADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
34 PsiBlast_CBE 88.8664%-109 - C3 -4KWE FTSZ_MYCTU B:[25-315] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVG----------ADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
20 PsiBlast_PDB 88.6764%-100 - C3 -2Q1Y FTSZ_MYCTU A:[22-312] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDSTRGLGAGADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
39 PsiBlast_CBE 88.6564% -99 - C3 -1RLU FTSZ_MYCTU A:[25-315] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDSTRGLGAGADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
37 PsiBlast_CBE 88.3664%-100 - C3 -1RQ2 FTSZ_MYCTU A:[25-315] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDST-----GADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
33 PsiBlast_CBE 88.3464%-108 - C3 -4KWE FTSZ_MYCTU C:[25-315] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVG----------ADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
36 PsiBlast_CBE 88.0164%-103 - C3 -1RQ7 FTSZ_MYCTU A:[25-315] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDST-----GADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
19 PsiBlast_PDB 87.0264%-101 - C3 -2Q1X FTSZ_MYCTU A:[22-312] ----------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDS-------ADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-ASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-----------------------------------------------------------------------------
63 HHSearch 86.3954% -92 - C3 -2VAW FTSZ_PSEAE A:[2-316] -----FELVDNIAQTAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-----------------------------------------------------------------------------
65 HHSearch 86.0856% -98 * C3 *1OFU FTSZ_PSEAE A:[11-317] --------------TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-G---------------------------------------------------------------------------
67 HHSearch 83.3547% -96 - C3 -2VAP FTSZ1_METJA A:[33-348] ----------LQQTKAKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVP-NMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VDIDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITGV-QSRIEFTD--------------------------------------------------------------------
58 PsiBlast_CBE 82.9948% -93 - C3 -1W5A FTSZ1_METJA A:[29-339] ----LLEY--LQQTKAKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VDIDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG------------------------------------------------------------------------------
42 PsiBlast_CBE 82.8656% -96 - C3 -1OFU FTSZ_PSEAE A:[25-316] ----------------------------NAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-----------------------------------------------------------------------------
57 PsiBlast_CBE 82.8348% -96 - C3 -1W5A FTSZ1_METJA B:[29-339] ----LLEY--LQQTKAKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VDIDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG------------------------------------------------------------------------------
41 PsiBlast_CBE 82.8156% -95 - C3 -1OFU FTSZ_PSEAE B:[25-316] ----------------------------NAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-----------------------------------------------------------------------------
56 PsiBlast_CBE 82.6148% -99 - C3 -1W5B FTSZ1_METJA A:[29-339] ----LLEY--LQQTKAKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VDIDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG------------------------------------------------------------------------------
55 PsiBlast_CBE 82.6148% -94 - C3 -1W5B FTSZ1_METJA B:[29-339] ----LLEY--LQQTKAKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VDIDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG------------------------------------------------------------------------------
40 PsiBlast_CBE 82.5756% -95 - C3 -2VAW FTSZ_PSEAE A:[25-316] ----------------------------NAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-----------------------------------------------------------------------------
54 PsiBlast_CBE 82.5648% -99 - C3 -2VAP FTSZ1_METJA A:[29-339] ----LLEY--LQQTKAKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVAD