@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2052: (2016-03-31 )
MGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK

Atome Classification :

(71 SA) .........10........20........30........40...-.--....50........60.......-.70........80........90........100.......110.......120.......130.......140.......150.......160
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKK-P--LFTIEERMEMIRQVTAHLPNVQV-ESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK
98 HHSearch 92.3163%-131 - C1 -1O6B COAD_BACSU A:[2-158] --ASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKK-P--LFSVEERCELLREVTKDIPNITV-ETSQGLLIDYARRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMANNQYSFLSSSIVKEVARYDGSVSEFVPPEVELALQQKF-
1 PsiBlast_PDB 90.9762%-134 - C1 -1O6B COAD_BACSU A:[4-159] ----IAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKK-P--LFSVEERCELLREVTKDIPNITV-ETSQGLLIDYARRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMANNQYSFLSSSIVKEVARYDGSVSEFVPPEVELALQQKFR
29 PsiBlast_CBE 86.7760%-121 - C1 -4NAH COAD_STAAW B:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
25 PsiBlast_CBE 86.6460%-123 - C1 -4NAH COAD_STAAW F:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
28 PsiBlast_CBE 86.3660%-119 - C1 -4NAH COAD_STAAW C:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
2 PsiBlast_PDB 85.9260%-125 - C1 -4NAH COAD_STAAW A:[2-160] -EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
26 PsiBlast_CBE 85.9060%-119 - C1 -4NAH COAD_STAAW E:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
4 PsiBlast_PDB 85.8660%-124 - C1 -4NAU COAD_STAAW A:[2-160] -EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
21 PsiBlast_CBE 85.5760%-120 - C1 -4NAU COAD_STAAW C:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
96 HHSearch 85.3849%-126 - C1 -3NBK COAD_MYCTU A:[20-176] -HMTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIA-GVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
22 PsiBlast_CBE 85.2860%-118 - C1 -4NAU COAD_STAAW B:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
12 PsiBlast_PDB 85.2250%-131 - C1 -3NBK COAD_MYCTU A:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
38 PsiBlast_CBE 85.0050%-133 - C1 -3NBK COAD_MYCTU C:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
27 PsiBlast_CBE 84.9760%-122 - C1 -4NAH COAD_STAAW D:[2-160] -EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
47 PsiBlast_CBE 84.6750%-126 - C1 -4R0N COAD_MYCTU C:[3-155] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
35 PsiBlast_CBE 84.6250%-129 - C1 -3PNB COAD_MYCTU C:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
5 PsiBlast_PDB 84.5560%-122 - C1 -3F3M COAD_STAAW A:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLK------G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
31 PsiBlast_CBE 84.3651%-124 - C1 -1H1T COAD_ECOLI B:[3-158] ---KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-P--MFTLEERVALAQQATAHLGNVEV-VGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKL-
10 PsiBlast_PDB 84.0551%-120 - C1 -1H1T COAD_ECOLI A:[3-158] ---KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-P--MFTLEERVALAQQATAHLGNVEV-VGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKL-
13 PsiBlast_PDB 83.9250%-133 - C1 -3PNB COAD_MYCTU A:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
37 PsiBlast_CBE 83.8050%-130 - C1 -3NBK COAD_MYCTU D:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
24 PsiBlast_CBE 83.7460%-119 - C1 -4NAT COAD_STAAW B:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLK----E-G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
33 PsiBlast_CBE 83.6151%-118 - C1 -1B6T COAD_ECOLI B:[3-158] ---KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-P--MFTLEERVALAQQATAHLGNVEV-VGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKL-
36 PsiBlast_CBE 83.3150%-134 - C1 -3PNB COAD_MYCTU B:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
39 PsiBlast_CBE 83.2450%-133 - C1 -3NBK COAD_MYCTU B:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
51 PsiBlast_CBE 83.2052%-129 - C1 -1VLH COAD_THEMA F:[15-169] -----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-C--MFTLEERKKLIEEVLSDLDGVKV-DVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
23 PsiBlast_CBE 82.9460%-124 - C1 -4NAT COAD_STAAW C:[1-160] MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLK------G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
20 PsiBlast_PDB 82.9250%-129 - C1 -4E1A COAD_MYCTU A:[4-156] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
56 PsiBlast_CBE 82.8452%-127 - C1 -1VLH COAD_THEMA A:[15-169] -----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-C--MFTLEERKKLIEEVLSDLDGVKV-DVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
17 PsiBlast_PDB 82.6950%-130 - C1 -3RHS COAD_MYCTU A:[4-156] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
93 HHSearch 82.5951%-126 - C1 -1VLH COAD_THEMA A:[13-169] ---MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-C--MFTLEERKKLIEEVLSDLDGVKV-DVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
54 PsiBlast_CBE 82.5452%-131 - C1 -1VLH COAD_THEMA C:[15-169] -----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-C--MFTLEERKKLIEEVLSDLDGVKV-DVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
55 PsiBlast_CBE 82.4752%-129 - C1 -1VLH COAD_THEMA B:[15-169] -----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-C--MFTLEERKKLIEEVLSDLDGVKV-DVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
52 PsiBlast_CBE 82.4552%-130 - C1 -1VLH COAD_THEMA E:[15-169] -----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-C--MFTLEERKKLIEEVLSDLDGVKV-DVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
92 HHSearch 82.4454%-130 - C1 -1OD6 COAD_THET8 A:[1-159] ---MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLEN----QY--LFSAEERLAIIREATAHLANVEA-ATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLG
34 PsiBlast_CBE 82.4250%-129 - C1 -3PNB COAD_MYCTU D:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
30 PsiBlast_CBE 82.3651%-115 - C1 -1QJC COAD_ECOLI B:[2-157] ---KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-P--MFTLEERVALAQQATAHLGNVEV-VGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKL-
19 PsiBlast_PDB 82.2950%-132 - C1 -3LCJ COAD_MYCTU A:[4-156] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
9 PsiBlast_PDB 82.1351%-117 - C1 -1GN8 COAD_ECOLI A:[3-158] ---KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-P--MFTLEERVALAQQATAHLGNVEV-VGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKL-
6 PsiBlast_PDB 82.0754%-135 - C1 -1OD6 COAD_THET8 A:[4-158] ------VYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLEN------QYLFSAEERLAIIREATAHLANVEA-ATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKL-
3 PsiBlast_PDB 82.0460%-128 - C1 -4NAT COAD_STAAW A:[2-160] -EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVL-------G--TFSLEERMDLIEQSVKHLPNVKV-HQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
32 PsiBlast_CBE 81.9351%-118 - C1 -1GN8 COAD_ECOLI B:[3-158] ---KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-P--MFTLEERVALAQQATAHLGNVEV-VGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKL-
53 PsiBlast_CBE 81.9252%-129 - C1 -1VLH COAD_THEMA D:[15-169] -----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-C--MFTLEERKKLIEEVLSDLDGVKV-DVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
42 PsiBlast_CBE 81.4550%-124 - C1 -3NBA COAD_MYCTU B:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
97 HHSearch 81.2147%-124 - C1 -3K9W COAD_BURP1 A:[21-178] -SMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKK-P--FFSLEERLKIANEVLGHYPNVKV-MGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKV-
18 PsiBlast_PDB 80.9550%-128 - C1 -3UC5 COAD_MYCTU A:[4-156] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
41 PsiBlast_CBE 80.8650%-128 - C1 -3NBA COAD_MYCTU C:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
15 PsiBlast_PDB 80.4950%-128 - C1 -3RBA COAD_MYCTU A:[4-156] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
40 PsiBlast_CBE 80.3750%-129 - C1 -3NBA COAD_MYCTU D:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
58 PsiBlast_CBE 80.1348%-127 - C1 -3K9W COAD_BURP1 A:[24-177] ----VAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKK-P--FFSLEERLKIANEVLGHYPNVKV-MGFTGLLKDFVRANDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEK--
49 PsiBlast_CBE 78.7550%-121 - C1 -3L93 COAD_YERPE A:[8-161] -----AIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKK-P--MFTLDERVALAKKVTAPLKNVEV-LGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKL-
50 PsiBlast_CBE 78.6350%-123 - C1 -3L92 COAD_YERPE A:[8-161] -----AIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKK-P--MFTLDERVALAKKVTAPLKNVEV-LGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKL-
57 PsiBlast_CBE 78.4348%-132 - C1 -3PXU COAD_BURP1 A:[7-160] ----VAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKK-P--FFSLEERLKIANEVLGHYPNVKV-MGFTGLLKDFVRANDARVIVRGLRA---FEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEK--
11 PsiBlast_PDB 77.4250%-128 - C1 -3NBA COAD_MYCTU A:[24-176] -----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-G--MFDLDERIAMVKESTTHLPNLRV-QVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-
72 PsiBlast_CBE 75.1043%-122 - C1 -3OTW COAD_HELPY E:[9-154] ---KIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-P--MFSLDERLKMIQLATKSFKNVEC-VAFEGLLANLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPK-----------
76 PsiBlast_CBE 75.0843%-123 - C1 -3OTW COAD_HELPY A:[9-154] ---KIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-P--MFSLDERLKMIQLATKSFKNVEC-VAFEGLLANLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPK-----------
63 PsiBlast_CBE 74.9245%-132 - C1 -3ND7