@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2089: (2016-03-31 )
VKNTIKWIAIGFAGIILLPLLIVFFIYKKAVGKKDYNPEVLENLDKASQEFVKNTSPLSDVDSRYKYMRLATKALPSAKDIEIGDVENKKIDGPAGKIPIRIYTPQEDGPFEIIVYYHGGGFVLGGLQTHDAIARKLVQTTGARVVTVDYRLAPENPFPAAVEDAYAALLWVQNHRTSLRAKSSDIIVAGDSVGGNLATVVTQIAKSKGKPNITAQILLYPATDIFSRDASVLYPSMDEFAEGYVLTKESLDKFFKLYIANASDRKYDPLVAPIRSKDLVGLPKTFIATAEFDPLRDQGEAYAKKLKDAGVEVFAKRFEKVPHGFMTTNSEATDETYELISEFLEEK

Atome Classification :

(38 SA) .........10........20........30........40........50........60....---....70........-80........90.....--...100.....-.-.110.......120.......130.......140-.......150.......160.......170.......180....-....190.......200.......210.......220.--..-....230.......240..-......250.......---260..----.....270...--....280.......290.......300.......310.......320.....--..330---.........340.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) VKNTIKWIAIGFAGIILLPLLIVFFIYKKAVGKKDYNPEVLENLDKASQEFVKNTSPLSDVDSRY---KYMRLATKALPSAK-DIEIGDVENKKIDGPAG--KIPIRIYTPQE-D-GPFEIIVYYHGGGFVLGGLQTHDAIARKLVQTTG-ARVVTVDYRLAPENPFPAAVEDAYAALLWVQNHRTSLR-AKSSD-IIVAGDSVGGNLATVVTQIAKSKGKPNITAQILLYPAT--DI-FSRDASVLYPSMDEFA-EG-YVLTKESLDKFFKLYI---ANASD----RKYDPLVAPIR--SKDLVGLPKTFIATAEFDPLRDQGEAYAKKLKDAGVEVFAKRFEKVPHGFMT--TNS-----EATDETYELISEFLEEK
81 HHSearch 88.3943%-101 * C1 *3WJ1 ? A:[44-299] ---------------------------------------------------------------------------------------RKVEDIKIPGSET--SINARVYFPKA-K-GPYGVLVYLHGGGFVIGDVESYDPLCRAITNACN-CVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFD-G-EMG-IAIAGDSAGGNLAAVVALLSKGK--LDLKYQILIYPAV--GF-DS-----VSRSMIEYS-DG-FFLTREHIEWFGSQYL---RSPAD----L-LDFRFSPII--AQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLS--FFPLI---DQGKDAIGLIGSVLRR-
83 HHSearch 88.2640% -99 - C1 -1JJI ? A:[53-310] --------------------------------------------------------------------------------------VERVEDRTIKGRNG--DIRVRVYQQKP----DSPVLVYYHGGGFVICSIESHDALCRRIARLSN-STVVSVDYRLAPEHKFPAAVYDCYDATKWVAENAEELR-IDPSK-IFVGGDSAGGNLAAAVSIMARDSGEDFIKHQILIYPVV--NF-VAP-----TPSLLEFGEGL-WILDQKIMSWFSEQYF---SREED----K-FNPLASVIF--A-DLENLPPALIITAEYDPLRDEGEVFGQMLRRAGVEASIVRYRGVLHGFIN--YYPVL---KAARDAINQIAALLVF-
1 PsiBlast_PDB 86.6543% -92 - C1 -3WJ1 ? A:[22-278] ----------------------------------------------------------ASVDEVR---KIFRQLASAAPKA----EVRKVEDIKIPGSET--SINARVYFPKA-K-GPYGVLVYLHGGGFVIGDVESYDPLCRAITNACN-CVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFD-GEMG--IAIAGDSAGGNLAAVVALL--SKGKLDLKYQILIYPAVGFDS-VSR-------SMIEYS-DG-FFLTREHIEWFGSQYL---RSPAD----L-LDFRFSPII--AQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLS---------------------------
8 PsiBlast_PDB 84.7642% -92 - C1 -4P9N - ? A:[21-277] ----------------------------------------------------------ASVDEVR---KIFRQLASAAPKA----EVRKVEDIKIPGSET--SINARVYFPKA-K-GPYGVLVYLHGGGFVIGDVESYDPLCRAITNACN-CVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFD-GEMG--IAIAGDSAGGNLAAVVALL--SKGKLDLKYQILIYPAVGFDS-VSR-------SMIEYS-DG-FFLTREHIEWFGSQYL---RSPAD----L-LDFRFSPII--AQDLSGLPPALIITAEYDPLRDPEEAYANRLLQAGVPVTSVRFNNVIHGFLS---------------------------
69 Fugue 79.9234% -74 - C1 -1JJI ? A:[1-311] ------------------------------MLDMPIDPVYYQLAEYFDSLPKFDQFSSAREYREA---INRIYEERNRQLSQ-HERVERVEDRTIKGRNG--DIRVRVYQQKP-D---SPVLVYYHGGGFVICSIESHDALCRRIARLSN-STVVSVDYRLAPEHKFPAAVYDCYDATKWVAENAEELR-IDPSK-IFVGGDSAGGNLAAAVSIMARDSGEDFIKHQILIYPVV--NF-VAPT-----PSLLEFG-EGLWILDQKIMSWFSEQYF---SREED----KF-NPLASVIF--A-DLENLPPALIITAEYDPLRDEGEVFGQMLRRAGVEASIVRYRGVLHGFINYYPVL-----KAARDAINQIAALLVFD
2 PsiBlast_PDB 79.7938% -72 - C1 -1QZ3 ? A:[3-299] -------------------------------------------LDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVK-KEPVAEVREFDMDLPGR--TLKVRMYRPEGVE-PPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGR-AVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFH-LDPAR-IAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPST------GYDPAHPPASIEENA-EG-YLLTGGMSLWFLDQYL----NSLE----ELTHPWFSPVL--YPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQ--FYS-----LSPGATKALV-------
82 HHSearch 79.5533% -95 - C1 -1LZL - ? A:[49-318] ---------------------------------------------------------------------------------------VSLRELSAPGLDGDPEVKIRFVTPDN-TAGPVPVLLWIHGGGFAIGTAESSDPFCVEVARELG-FAVANVEYRLAPETTFPGPVNDCYAALLYIHAHAEELG-IDPSR-IAVGGQSAGGGLAAGTVLKARDEGVVPVAFQFLEIPEL--DD-R-----LETVSMTNFV-DT-PLWHRPNAILSWKYYL---GESYSGPEDPDVSIYAAPSR--ATDLTGLPPTYLSTMELDPLRDEGIEYALRLLQAGVSVELHSFPGTFHGSAL--VATAAVSERGAAEALTAIRRGLRS-
85 HHSearch 79.4241% -94 - C1 -2HM7 ? A:[45-308] --------------------------------------------------------------------------------------VAEVREFDMDLPGR--TLKVRMYRPEG-VEPPYPALVYYHGGSWVVGDLETHDPVCRVLAK-DGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFH-LDPAR-IAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPST--GY-DPAHP---PASIEENA-EG-YLLTGGMMLWFRDQYL---NSLEE----L-THPWFSPVL--YPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQ--FYSLS---PGATKALVRIAEKLRDA
4 PsiBlast_PDB 78.8442% -96 - C1 -1JJI ? A:[56-289] -----------------------------------------------------------------------------------------VEDRTIKGRNG--DIRVRVYQQKP-D-SP--VLVYYHGGGFVICSIESHDALCRRIARLSN-STVVSVDYRLAPEHKFPAAVYDCYDATKWVAENAEELR-IDPSK-IFVGGDSAGGNLAAAVSIMARDSGEDFIKHQILIYPVV--NF-VAPT-----PSLLEFG-EGLWILDQKIMSWFSEQYF---SREED-----KFNPLASVIF--A-DLENLPPALIITAEYDPLRDEGEVFGQMLRRAGVEASIVRYRGVLHGFIN---------------------------
12 PsiBlast_PDB 78.1042% -90 - C1 -3AIN ? A:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVGFNNVIHGFVS---------------------------
9 PsiBlast_PDB 78.0438% -77 - C1 -1EVQ ? A:[3-299] -------------------------------------------LDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVK-KEPVAEVREFDMDLPGR--TLKVRMYRPEGVE-PPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGR-AVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFH-LDPAR-IAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPST------GYDPAHPPASIEENA-EG-YLLTGGMMLWFRDQYL----NSLE----ELTHPWFSPVL--YPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQ--FYS-----LSPGATKALV-------
29 PsiBlast_CBE 77.5042% -87 - C1 -3AIK ? B:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
32 PsiBlast_CBE 77.2542% -88 - C1 -3AIO ? B:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVKFNNVIHGFVS---------------------------
21 PsiBlast_CBE 77.2342% -96 - C1 -1JJI ? D:[56-289] -----------------------------------------------------------------------------------------VEDRTIKGRNG--DIRVRVYQQKP-D-SP--VLVYYHGGGFVICSIESHDALCRRIARLSN-STVVSVDYRLAPEHKFPAAVYDCYDATKWVAENAEELR-IDPSK-IFVGGDSAGGNLAAAVSIMARDSGEDFIKHQILIYPVV--NF-VAPT-----PSLLEFG-EGLWILDQKIMSWFSEQYF---SREED-----KFNPLASVIF--A-DLENLPPALIITAEYDPLRDEGEVFGQMLRRAGVEASIVRYRGVLHGFIN---------------------------
33 PsiBlast_CBE 77.1542% -89 - C1 -3AIM ? D:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVS---------------------------
10 PsiBlast_PDB 77.1242% -91 - C1 -3AIO ? A:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVKFNNVIHGFVS---------------------------
6 PsiBlast_PDB 77.0442% -90 - C1 -3AIK ? A:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
24 PsiBlast_CBE 76.9742% -89 - C1 -3AIL ? D:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
25 PsiBlast_CBE 76.9042% -91 - C1 -3AIL ? C:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
38 PsiBlast_CBE 76.8842% -88 - C1 -3AIN ? B:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVGFNNVIHGFVS---------------------------
27 PsiBlast_CBE 76.7942% -91 - C1 -3AIK ? D:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
11 PsiBlast_PDB 76.7142% -90 - C1 -3AIM ? A:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVS---------------------------
37 PsiBlast_CBE 76.4742% -88 - C1 -3AIN ? C:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVGFNNVIHGFVS---------------------------
36 PsiBlast_CBE 76.2342% -87 - C1 -3AIN ? D:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVGFNNVIHGFVS---------------------------
26 PsiBlast_CBE 76.1642% -90 - C1 -3AIL ? B:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
35 PsiBlast_CBE 75.4642% -90 - C1 -3AIM ? B:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVS---------------------------
28 PsiBlast_CBE 75.4342% -88 - C1 -3AIK ? C:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
34 PsiBlast_CBE 75.3342% -89 - C1 -3AIM ? C:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVS---------------------------
7 PsiBlast_PDB 75.3042% -88 - C1 -3AIL ? A:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVRFNNVIHGFVS---------------------------
30 PsiBlast_CBE 75.2942% -90 - C1 -3AIO ? D:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVKFNNVIHGFVS---------------------------
31 PsiBlast_CBE 75.2342% -89 - C1 -3AIO ? C:[61-297] -------------------------------------------------------------------------------------EVGKIEDITIPGSET--NIKARVYYPKT-Q-GPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQ-CVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFN-GKYG--IAVGGDSAGGNLAA-VTAILSKKENIKLKYQVLIYPAV--SF------DLITKSLYDNG-EG-FFLTREHIDWFGQQYLRSFADLLD----FRFSPILA-------DLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVKFNNVIHGFVS---------------------------
16 PsiBlast_PDB 74.0936% -70 - C1 -4OB8 ? A:[19-307] -------------------------------GVEQHTQAFLEALEQGGGKPLEQLSP---KDAR-------AVLTGAQASVKVDLSGIEVKERTIQANGQ--SIKLQVVRPANVK-GELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSG-AVAVYVDYTPSPESHYPTAINQAYAATQWVAEHGKEIG-VDGKR-LAVAGNSVGGNMAAVVALKAKEAGTPALRFQLLLWPVT--------DASFETASYKQFA-DG-HFLTTGMMKWFWDNYT---TDAKA----RE-QIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGL--LN-----------------------
17 PsiBlast_PDB 73.5636% -71 - C1 -4OB7 ? A:[19-307] -------------------------------GVEQHTQAFLEALEQGGGKPLEQLSP---KDAR-------AVLTGAQASVKVDLSGIEVKERTIQANGQ--SIKLQVVRPANVK-GELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSG-AVAVYVDYTPSPESHYPTAINQAYAATQWVAEHGKEIG-VDGKR-LAVAGNSVGGNMAAVVALKAKEAGTPALRFQLLLHPVT--------DASFETASYKQFA-DG-HFLTTGMMKWFWDNYT---TDAKA----RE-QIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGL--LN-----------------------