@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2457: (2016-04-03 )
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTDLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTSADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEPASFLALLEAVK

Atome Classification :

(54 SA) -.........10........20........30........40.....-...50--...--...---...60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALF-LQEL---VRL--TEG---TDLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTSADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEPASFLALLEAVK
101 HHSearch 98.1565% -87 - C8 -2BTM TPIS_GEOSE A:[1-249] --RKPIIAGNWKMNGTLAEAVQFVEDVKGHVPPADEVISVVCAPFLF-LDRL---VQA--ADG---TDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEAG-
123 Fugue 98.0765% -88 - C8 -2BTM TPIS_GEOSE A:[1-250] --RKPIIAGNWKMNGTLAEAVQFVEDVKGHVPPADEVISVVCAPFLF-LDRL---VQAAD--G---TDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEAGR
1 PsiBlast_PDB 97.7865% -86 - C8 -2BTM TPIS_GEOSE A:[1-248] --RKPIIAGNWKMNGTLAEAVQFVEDVKGHVPPADEVISVVCAPFLF-LDRL---VQA--ADG---TDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEA--
7 PsiBlast_PDB 97.4762% -92 - C8 -3UWY - TPIS_STAAR A:[1-253] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
5 PsiBlast_PDB 97.3262% -91 - C8 -3UWV TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
21 PsiBlast_CBE 97.0465% -84 - C8 -2BTM TPIS_GEOSE B:[1-248] --RKPIIAGNWKMNGTLAEAVQFVEDVKGHVPPADEVISVVCAPFLF-LDRL---VQA--ADG---TDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALVGGASLEPASFLQLVEA--
6 PsiBlast_PDB 96.8262% -93 - C8 -3UWW TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
2 PsiBlast_PDB 96.7664% -85 - C8 -1BTM TPIS_GEOSE A:[1-248] --RKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAPFLF-LDRL---VQA--ADG---TDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEA--
4 PsiBlast_PDB 96.7462% -91 - C8 -3UWU TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
108 HHSearch 96.6863% -91 - C8 -3M9Y TPIS_STAAR A:[2-254] -MRTPIIAGNWKMNKTVQEAKDFVNALPTLPD-SKEVESVICAPAIQ-LDAL---TTA--VKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIG--KSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
8 PsiBlast_PDB 96.4762% -91 - C8 -3UWZ TPIS_STAAR A:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
26 PsiBlast_CBE 96.4462% -90 - C8 -3UWV TPIS_STAAR B:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
25 PsiBlast_CBE 96.4162% -92 - C8 -3UWW TPIS_STAAR B:[10-260] --RTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGA-
23 PsiBlast_CBE 96.3462% -91 - C8 -3M9Y TPIS_STAAR B:[2-254] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
27 PsiBlast_CBE 95.8662% -92 - C8 -3UWU TPIS_STAAR B:[9-260] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGA-
3 PsiBlast_PDB 95.8362% -93 - C8 -3M9Y TPIS_STAAR A:[2-254] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIG--KSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
22 PsiBlast_CBE 95.4464% -83 - C8 -1BTM TPIS_GEOSE B:[1-248] --RKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAPFLF-LDRL---VQA--ADG---TDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEPASFLQLVEA--
24 PsiBlast_CBE 94.6162% -92 - C8 -3UWZ TPIS_STAAR B:[9-261] -MRTPIIAGNWKMNKTVQEAKDFVNALPT-LPDSKEVESVICAPAIQ-LDALTTAVKE--GKA---QGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAI---KSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
9 PsiBlast_PDB 92.6658% -90 - C8 -4Y8F ? A:[4-249] -MRTPIIAGNWKMHYTIDEAVKLVEELKPLV--KDAKCEVVVCPTFVCLDAV---KKA--VEG---TNIKVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIV----
103 HHSearch 91.4947% -86 - C8 -1B9B PGKT_THEMA A:[2-250] -TRKLILAGNWKMHKTISEAKKFVSLLVNELHDVKEFEIVVCPPFTA-LSEV---GEI--LSG---RNIKLGAQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTFCVVEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEMYDEETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKE-SFIELARIM-
49 PsiBlast_CBE 85.3641% -79 - C8 -4MVA ? A:[25-272] -MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMY-IDMA---KRE--AEG---SHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-VDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKA--
122 Fugue 85.1342% -75 - C8 -1IF2 TPIS_LEIME A:[3-251] AKPQPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
97 PsiBlast_CBE 85.0442% -78 - C8 -1N55 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNA-IAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
91 PsiBlast_CBE 84.9041% -71 - C8 -1TPV TPIS_CHICK A:[3-245] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGNPERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKTHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--
109 HHSearch 84.8542% -77 - C8 -2VXN TPIS_LEIME A:[4-250] -KPQPIAAANWKCNGTTASIEKLVQVFNEHTI-SHDVQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNAI-AKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKPE-FRDIIDAT-
46 PsiBlast_CBE 84.8043% -81 - C8 -2I9E ? B:[3-245] --RKFVVGGNWKMNGDKKQINEIIGFLKSG-PLNQDTEVVVGVPAIY-L-EL---VRT--CVP---ASIGVAAQNCYKVPKGAFTGEISPAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGETLEEREAGKTEEVVFRQTKAIAAKVNDWSNV--VIAYEPVWAIGTGKTATPQQAQDVHKALRQWICENIDAKVGNSIRIQYGGSVTAANCKELASQPDIDGFLVGGASLKP-EFVDIINA--
92 PsiBlast_CBE 84.7842% -77 - C8 -2Y63 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNA-IAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
94 PsiBlast_CBE 84.6442% -76 - C8 -2Y61 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNA-IAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
93 PsiBlast_CBE 84.6442% -78 - C8 -2Y62 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNA-IAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
95 PsiBlast_CBE 84.5242% -77 - C8 -2VXN TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNA-IAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
44 PsiBlast_CBE 84.4943% -84 - C8 -2I9E ? D:[3-245] --RKFVVGGNWKMNGDKKQINEIIGFLKSG-PLNQDTEVVVGVPAIY-L-EL---VRT--CVP---ASIGVAAQNCYKVPKGAFTGEISPAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGETLEEREAGKTEEVVFRQTKAIAAKVNDWSNV--VIAYEPVWAIGTGKTATPQQAQDVHKALRQWICENIDAKVGNSIRIQYGGSVTAANCKELASQPDIDGFLVGGASLKP-EFVDIINA--
98 PsiBlast_CBE 84.4242% -77 - C8 -1IF2 TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNA-IAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
48 PsiBlast_CBE 84.1041% -81 - C8 -4MVA ? B:[25-272] -MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMY-IDMA---KRE--AEG---SHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAK-VDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKA--
64 PsiBlast_CBE 83.8142% -73 - C8 -1SW7 TPIS_CHICK B:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGNSSTPQQAQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--
96 PsiBlast_CBE 83.6242% -77 - C8 -1QDS TPIS_LEIME A:[6-251] ---QPIAAANWKCNGTTASIEKLVQVFNEHTISHD-VQCVVAPTFVH-IPLV---QAK--LRN---PKYVISAQNA-IAKSGAFTGEVSMPILKDIGVHWVILGHSERRTYYGETDEIVAQKVSEACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIAAKLTKDAWNQVVLAYEPVWAIGTGKVATPEQAQEVHLLLRKWVSENIGTDVAAKLRILYGGSVNAANAATLYAKPDINGFLVGGASLKP-EFRDIIDATR
90 PsiBlast_CBE 83.5041% -70 - C8 -1TPV TPIS_CHICK B:[3-245] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGNPERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKTHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--
104 HHSearch 83.3838% -82 - C8 -2J27 TPIS_TRYBB A:[3-250] -KPQPIAAANWKCNGSQQSLSELIDLFNSTSI-NHDVQCVVASTFVH-LAMT---KER--LSH---PKFVIAAQNAI-AKSGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGFMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEAVWAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPE-FVDIIKATQ
71 PsiBlast_CBE 83.1941% -72 - C8 -1SW3 TPIS_CHICK A:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGKVATPQQAQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--
82 PsiBlast_CBE 83.1241% -67 - C8 -1TPU TPIS_CHICK B:[3-245] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGNSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKTHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--
75 PsiBlast_CBE 83.1141% -73 - C8 -1SSG TPIS_CHICK A:[3-245] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGYSLTPQQAQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--
65 PsiBlast_CBE 83.0942% -71 - C8 -1SW7 TPIS_CHICK A:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGNSSTPQQAQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--
85 PsiBlast_CBE 83.0241% -73 - C8 -1SW0 TPIS_CHICK A:[4-246] --RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSAD-TEVVCGAPSIY-L-DF---ARQ--KLD---AKIGVAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWS--KVVLAYEPVWAIGTGLWATPQQAQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKP-EFVDIINA--