@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2471: (2016-04-04 )
MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFHFAHYVSRAAGGTGLVILEATAVQEVGRISEFDLGLWNDEQVPALKKLVGGLHYHGAKAGIQLAHAGRKAVLPGEIVAPSAIAFDEKSDKPVELTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILSDIIKAVKEVWDGPIIVRVSATDYAHGGLQLEDHIPFAKWMKADGVELIDVSTGGLVNVAPPVFPGYQVPFADEIRRGAGIATGALGLITRGEQAEEILCNERADLIIVGRELLRNPYFAKDAAKQLGETIEAPKQYSRAWK

Atome Classification :

(44 SA) .........10........20........30........40.........50........60........70..-......80........90........100.....---..----------110--.----------.-.-----....120---.---------------......---------------.----------.130--------------------...----....140..-.....150.......160.......170.......180.......190.......200.-...--.--..-210.......220.......230.......240.......250.-....-..260.......270.......280.......290.......300.......310.......320.......330......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFH-FAHYVSRAAGGTGLVILEATAVQEVGRISEFDL-GLWNDEQVPALKKLVGGLHYHGAKAGIQLAHAGR---KA----------VLP--G----------E-I-----VAPSA-----I---------------AFDEKS---------------D----------KPVE--------------------LTK----EAIKEVVAD-FKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILSDIIKAV-KEV--W--DG-PIIVRVSATDYAHGGLQLEDHIPFAKWMKADGVELIDVSTGGLV-NVAP-PVFPGYQVPFADEIRRGAGIATGALGLITRGEQAEEILCNERADLIIVGRELLRNPYFAKDAAKQLGETIEAPKQYSRAWK
111 HHSearch 98.2562%-103 - C4 -1Z41 NAMA_BACSU A:[2-338] ARKLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFH-MAHYISRAIGQVGLIIVEASAVNPQGRITDQDL-GIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGR---KA----------ELE--G----------D-I-----FAPSA-----I---------------AFDEQS---------------A----------TPVE--------------------MSA----EKVKETVQE-FKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEV-KQV--W---DGPLFVRVSASDYTDKGLDIADHIGFAKWMKEQGVDLIDCSSGALV-HADI-NVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW-
3 PsiBlast_PDB 98.1261%-103 - C4 -1Z41 NAMA_BACSU A:[4-338] --KLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFH-MAHYISRAIGQVGLIIVEASAVNPQGRITDQDL-GIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGR---KA----------ELE--G----------D-I-----FAPSA-----I---------------AFDEQS---------------A----------TPVE--------------------MSA----EKVKETVQE-FKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEV-KQV--W--DG-PLFVRVSASDYTDKGLDIADHIGFAKWMKEQGVDLIDCSSGALV-HADI-NVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW-
5 PsiBlast_PDB 98.0861%-104 - C4 -1Z44 NAMA_BACSU A:[4-338] --KLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFH-MAHYISRAIGQVGLIIVEASAVNPQGRITDQDL-GIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGR---KA----------ELE--G----------D-I-----FAPSA-----I---------------AFDEQS---------------A----------TPVE--------------------MSA----EKVKETVQE-FKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEV-KQV--W--DG-PLFVRVSASDYTDKGLDIADHIGFAKWMKEQGVDLIDCSSGALV-HADI-NVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW-
4 PsiBlast_PDB 97.7461%-103 - C4 -1Z42 NAMA_BACSU A:[4-338] --KLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFH-MAHYISRAIGQVGLIIVEASAVNPQGRITDQDL-GIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGR---KA----------ELE--G----------D-I-----FAPSA-----I---------------AFDEQS---------------A----------TPVE--------------------MSA----EKVKETVQE-FKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEV-KQV--W--DG-PLFVRVSASDYTDKGLDIADHIGFAKWMKEQGVDLIDCSSGALV-HADI-NVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW-
6 PsiBlast_PDB 97.4361%-104 - C4 -1Z48 NAMA_BACSU A:[4-338] --KLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFH-MAHYISRAIGQVGLIIVEASAVNPQGRITDQDL-GIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGR---KA----------ELE--G----------D-I-----FAPSA-----I---------------AFDEQS---------------A----------TPVE--------------------MSA----EKVKETVQE-FKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEV-KQV--W--DG-PLFVRVSASDYTDKGLDIADHIGFAKWMKEQGVDLIDCSSGALV-HADI-NVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW-
2 PsiBlast_PDB 95.2559% -98 - C4 -3GR8 NAMA_GEOKA A:[3-339] -TMLFSPYTIRGLTLKNRIVMSPMCMYSCDTKDGAVRTWH-KIHYPARAVGQVGLIIVEATGVTPQGRISERDL-GIWSDDHIAGLRELVGLVKEHGAAIGIQLAHAGR---KS----------QVP--G----------E-I-----IAPSA-----V---------------PFDDSS---------------P----------TPKE--------------------MTK----ADIEETVQA-FQNGARRAKEAGFDVIEIHAAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLGEVIDAV-REV--W--DG-PLFVRISASDYHPDGLTAKDYVPYAKRMKEQGVDLVDVSSGAIV-PARM-NVYPGYQVPFAELIRREADIPTGAVGLITSGWQAEEILQNGRADLVFLGRELLRNPYWPYAAARELGAKISAPVQYERGWR
22 PsiBlast_CBE 95.1359%-101 - C4 -3GR7 NAMA_GEOKA B:[3-339] -TMLFSPYTIRGLTLKNRIVMSPMCMYSCDTKDGAVRTWH-KIHYPARAVGQVGLIIVEATGVTPQGRISERDL-GIWSDDHIAGLRELVGLVKEHGAAIGIQLAHAGR---KS----------QVP--G----------E-I-----IAPSA-----V---------------PFDDSS---------------P----------TPKE--------------------MTK----ADIEETVQA-FQNGARRAKEAGFDVIEIHAAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLGEVIDAV-REV--W--DG-PLFVRISASDYHPDGLTAKDYVPYAKRMKEQGVDLVDVSSGAIV-PARM-NVYPGYQVPFAELIRREADIPTGAVGLITSGWQAEEILQNGRADLVFLGRELLRNPYWPYAAARELGAKISAPVQYERGWR
1 PsiBlast_PDB 94.9559%-100 - C4 -3GR7 NAMA_GEOKA A:[3-339] -TMLFSPYTIRGLTLKNRIVMSPMCMYSCDTKDGAVRTWH-KIHYPARAVGQVGLIIVEATGVTPQGRISERDL-GIWSDDHIAGLRELVGLVKEHGAAIGIQLAHAGR---KS----------QVP--G----------E-I-----IAPSA-----V---------------PFDDSS---------------P----------TPKE--------------------MTK----ADIEETVQA-FQNGARRAKEAGFDVIEIHAAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLGEVIDAV-REV--W--DG-PLFVRISASDYHPDGLTAKDYVPYAKRMKEQGVDLVDVSSGAIV-PARM-NVYPGYQVPFAELIRREADIPTGAVGLITSGWQAEEILQNGRADLVFLGRELLRNPYWPYAAARELGAKISAPVQYERGWR
112 HHSearch 94.9159%-102 - C4 -3GR7 NAMA_GEOKA A:[2-338] NTMLFSPYTIRGLTLKNRIVMSPMCMYSCDTKDGAVRTWH-KIHYPARAVGQVGLIIVEATGVTPQGRISERDL-GIWSDDHIAGLRELVGLVKEHGAAIGIQLAHAGR---KS----------QVP--G----------E-I-----IAPSA-----V---------------PFDDSS---------------P----------TPKE--------------------MTK----ADIEETVQA-FQNGARRAKEAGFDVIEIHAAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLGEVIDAV-REV--W---DGPLFVRISASDYHPDGLTAKDYVPYAKRMKEQGVDLVDVSSGAIV-PARM-NVYPGYQVPFAELIRREADIPTGAVGLITSGWQAEEILQNGRADLVFLGRELLRNPYWPYAAARELGAKISAPVQYERGW-
21 PsiBlast_CBE 94.8459% -98 - C4 -3GR8 NAMA_GEOKA B:[3-339] -TMLFSPYTIRGLTLKNRIVMSPMCMYSCDTKDGAVRTWH-KIHYPARAVGQVGLIIVEATGVTPQGRISERDL-GIWSDDHIAGLRELVGLVKEHGAAIGIQLAHAGR---KS----------QVP--G----------E-I-----IAPSA-----V---------------PFDDSS---------------P----------TPKE--------------------MTK----ADIEETVQA-FQNGARRAKEAGFDVIEIHAAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLGEVIDAV-REV--W--DG-PLFVRISASDYHPDGLTAKDYVPYAKRMKEQGVDLVDVSSGAIV-PARM-NVYPGYQVPFAELIRREADIPTGAVGLITSGWQAEEILQNGRADLVFLGRELLRNPYWPYAAARELGAKISAPVQYERGWR
25 PsiBlast_CBE 91.0651%-103 - C4 -3KRZ ? B:[3-336] --ILHMPLKIKDITIKNRIMMSPMCMYSA-STDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--Y----------EDV-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WPENK-PIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYW---VLHTYTSKEDWPKQYERAFK
28 PsiBlast_CBE 90.9251%-100 - C4 -3KRU ? B:[2-336] -SILHMPLKIKDITIKNRIMMSPMCMYSA-STDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--Y----------EDV-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WPENK-PIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYW---VLHTYTSKEDWPKQYERAFK
24 PsiBlast_CBE 90.8951%-102 - C4 -3KRZ ? C:[3-336] --ILHMPLKIKDITIKNRIMMSPMCMYSA-STDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--Y----------EDV-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WPENK-PIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYW---VLHTYTSKEDWPKQYERAFK
26 PsiBlast_CBE 90.5451%-102 - C4 -3KRU ? D:[2-336] -SILHMPLKIKDITIKNRIMMSPMCMYSA-STDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--Y----------EDV-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WPENK-PIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYW---VLHTYTSKEDWPKQYERAFK
7 PsiBlast_PDB 90.1651% -99 - C4 -3KRU ? A:[2-336] -SILHMPLKIKDITIKNRIMMSPMCMYSA-STDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--Y----------EDV-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WPENK-PIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYW---VLHTYTSKEDWPKQYERAFK
114 HHSearch 90.0452%-100 - C4 -3KRU ? A:[2-327] -SILHMPLKIKDITIKNRIMMSPMCMYSAS-TDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--YE---------D-V-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WP-ENKPIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDW------------
27 PsiBlast_CBE 89.8751%-102 - C4 -3KRU ? C:[2-335] -SILHMPLKIKDITIKNRIMMSPMCMYSA-STDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--Y----------EDV-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WPENK-PIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYW---VLHTYTSKEDWPKQYERAF-
8 PsiBlast_PDB 89.8251%-101 - C4 -3KRZ ? A:[2-336] -SILHMPLKIKDITIKNRIMMSPMCMYSA-STDGMPNDWH-IVHYATRAIGGVGLIMQEATAVESRGRITDHDL-GIWNDEQVKELKKIVDICKANGAVMGIQLAHAGR---KC----------NIS--Y----------EDV-----VGPSP-----I---------------KAGDRY---------------K----------LPRE--------------------LSV----EEIKSIVKA-FGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEV-RKN--WPENK-PIFVRVSADDYMEGGINIDMMVEYINMIK-DKVDLIDVSSGGLL-NVDI-NLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYW---VLHTYTSKEDWPKQYERAFK
113 HHSearch 88.1049% -97 - C4 -3HGJ ? A:[2-349] -ALLFTPLELGGLRLKNRLAMSPMCQYSAT-LEGEVTDWH-LLHYPTRALGGVGLILVEATAVEPLGRISPYDL-GIWSEDHLPGLKELARRIREAGAVPGIQLAHAGR---KA----------GTA--RPWEGGKPLGWR-V-----VGPSP-----I---------------PFDEGY---------------P----------VPEP--------------------LDE----AGMERILQA-FVEGARRALRAGFQVIELHMAHGYLLSSFLSPLSNQRTDAYGGSLENRMRFPLQVAQAV-REV--VP-RELPLFVRVSATDWGEGGWSLEDTLAFARRLKELGVDLLDCSSGGVV-LRVRIPLAPGFQVPFADAVRKRVGLRTGAVGLITTPEQAETLLQAGSADLVLLGRVLLRDPYFPLRAAKALGVAPEVPPQYQRGF-
30 PsiBlast_CBE 87.0648% -95 - C4 -3HGJ ? C:[2-349] -ALLFTPLELGGLRLKNRLAMSPMCQYSA-TLEGEVTDWH-LLHYPTRALGGVGLILVEATAVEPLGRISPYDL-GIWSEDHLPGLKELARRIREAGAVPGIQLAHAGR---KAGTARPWEGGKPLG--W----------R-V-----VGPSP-----I---------------PFDEGY---------------P----------VPEP--------------------LDE----AGMERILQA-FVEGARRALRAGFQVIELHMAHGYLLSSFLSPLSNQRTDAYGGSLENRMRFPLQVAQAV-REVVPR--EL-PLFVRVSATDWGEGGWSLEDTLAFARRLKELGVDLLDCSSGGVVLRVRI-PLAPGFQVPFADAVRKRVGLRTGAVGLITTPEQAETLLQAGSADLVLLGRVLLRDPYFPLRAAKALGVAPEVPPQYQRGF-
68 PsiBlast_CBE 51.7235% -79 - C4 -4JIC ? A:[2-232] -TSLFEPAQAGDIALANRIVMAPLTRN--RSPGAIPNNLN-ATYYEQRAT--AGLIVTEGTPISQQGQGYADVP-GLYKREAIEGWKKITDGVHSAGGKIVAQIWHVGRISHTS----------LQPHGG----------Q-P-----VAPSA-----ITAKSKTYIINDDGTGAFAETS---------------E-----------PRA--------------------LTI----DDIGLILED-YRSGARAALEAGFDGVEIHAANGYLIEQFLKSSTNQRTDDYGGSIENRARFLLEVVDAVAEEI--G--AG-RTGIRLS----------------------------------------------------------------------------------------------------------------------------
67 PsiBlast_CBE 50.7535% -77 - C4 -4JIC ? B:[2-232] -TSLFEPAQAGDIALANRIVMAPLTRN--RSPGAIPNNLN-ATYYEQRAT--AGLIVTEGTPISQQGQGYADVP-GLYKREAIEGWKKITDGVHSAGGKIVAQIWHVGRISHTS----------LQPHGG----------Q-P-----VAPSA-----ITAKSKTYIINDDGTGAFAETS---------------E-----------PRA--------------------LTI----DDIGLILED-YRSGARAALEAGFDGVEIHAANGYLIEQFLKSSTNQRTDDYGGSIENRARFLLEVVDAVAEEI--G--AG-RTGIRLS----------------------------------------------------------------------------------------------------------------------------
96 PsiBlast_CBE 50.7032% -80 - C4 -3TJL ? A:[12-231] -SEAFQSIKVGNNTLQTKIVYPPTTRFRAL-EDHTPSDLQ-LQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPA----------VMK--T----------R-G-----LNPVS-----A---------------SATYES---------------DAAKEAAEAVGNPVRA-------------------LTT----QEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHL-STI-------------------------------------------------------------------------------------------------------------------------------------------
94 PsiBlast_CBE 50.7032% -80 - C4 -4M5P ? A:[12-231] -SEAFQSIKVGNNTLQTKIVYPPTTRFRAL-EDHTPSDLQ-LQYYGDRSTFPGTLLITEATFVSPQASGWEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLCFLGRVADPA----------VMK--T----------R-G-----LNPVS-----A---------------SATYES---------------DAAKEAAEAVGNPVRA-------------------LTT----QEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHL-STI-------------------------------------------------------------------------------------------------------------------------------------------
95 PsiBlast_CBE 49.5032% -78 - C4 -3UPW ? A:[12-231] -SEAFQSIKVGNNTLQTKIVYPPTTRFRAL-EDHTPSDLQ-LQYYGDRSTFPGTLLITEATFVSPQASGYEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLIFLGRVADPA----------VMK--T----------R-G-----LNPVS-----A---------------SATYES---------------DAAKEAAEAVGNPVRA-------------------LTT----QEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHL-STI-------------------------------------------------------------------------------------------------------------------------------------------