@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2538: (2016-04-04 )
MANVHVINHPLVQHKLTIIRDKNTGTKAFRELVDEVATLMAYEITRDMELEDIQVETPLQTTTAKTLTGKKLGIVPILRAGLGMQDGILKLIPAAKVGHVGLYRDHDTLEPVEYFVKLPSDVEERLFIVVDPMLATGGSAIMAIDCLKKRGARNMKFMCLVAAPEGVKALQDAHPDVEIYVAGLDEKLDENGYIRPGLGDAGDRLFGTK

Atome Classification :

(38 SA) .........10........20........30........40........50........--60........70........80........90........100....-------...110.......120....--...130.......140.......150-.--....--...160.......170.......180.......190.......200.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MANVHVINHPLVQHKLTIIRDKNTGTKAFRELVDEVATLMAYEITRDMELEDIQVETPL--QTTTAKTLTGKKLGIVPILRAGLGMQDGILKLIPAAKVGHVGLYRDH-------DTLEPVEYFVKLPSDVEERL--FIVVDPMLATGGSAIMAIDCLKKRG--A--RNMK--FMCLVAAPEGVKALQDAHPDVEIYVAGLDEKLDENGYIRPGLGDAGDRLFGTK
65 HHSearch 97.5075%-148 - C6 -1I5E UPP_BACCL A:[2-209] -GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIETPV--SKARAKVIAGKKLGVIPILRAGIGMVDGILKLIPAAKVGHIGLYRDP-------QTLKPVEYYVKLPSDVEERD--FIIVDPMLATGGSAVAAIDALKKRG--A--KSIK--FMCLIAAPEGVKAVETAHPDVDIYIAALDERLNDHGYIVPGLGDAGDRLFGTK
21 PsiBlast_CBE 97.4775%-148 - C6 -1I5E UPP_BACCL B:[2-209] -GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIETPV--SKARAKVIAGKKLGVIPILRAGIGMVDGILKLIPAAKVGHIGLYRDP-------QTLKPVEYYVKLPSDVEERD--FIIVDPMLATGGSAVAAIDALKKRG--A--KSIK--FMCLIAAPEGVKAVETAHPDVDIYIAALDERLNDHGYIVPGLGDAGDRLFGTK
1 PsiBlast_PDB 97.4075%-148 - C6 -1I5E UPP_BACCL A:[2-209] -GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIETPV--SKARAKVIAGKKLGVIPILRAGIGMVDGILKLIPAAKVGHIGLYRDP-------QTLKPVEYYVKLPSDVEERD--FIIVDPMLATGGSAVAAIDALKKRG--A--KSIK--FMCLIAAPEGVKAVETAHPDVDIYIAALDERLNDHGYIVPGLGDAGDRLFGTK
64 HHSearch 90.1660%-146 - C6 -3DMP - UPP_BURPS A:[7-213] FPNLFILDHPLIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRNLPITTKRVETPL--VEIDAPVIAGKKLAIVPVLRAGVGMSDGLLELIPSARVGHIGVYRAD-------D-HRPVEYLVRLP-DLEDRI--FILCDPMVATGYSAAHAIDVLKRRG--VPGERLM--FLALVAAPEGVQVFQDAHPDVKLYVASLDSHLDDHAYIVPGLGDAGDRLFG--
2 PsiBlast_PDB 88.9359%-143 - C6 -3DMP - UPP_BURPS A:[9-213] --NLFILDHPLIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRNLPITTKRVETPL--VEIDAPVIAGKKLAIVPVLRAGVGMSDGLLELIPSARVGHIGVYRAD-------DH-RPVEYLVRLP-DLEDRI--FILCDPMVATGYSAAHAIDVLKRRGVPG--ERLM--FLALVAAPEGVQVFQDAHPDVKLYVASLDSHLDDHAYIVPGLGDAGDRLFG--
62 HHSearch 88.9058%-145 - C6 -1V9S UPP_THET2 A:[1-208] -MRITLVDHPLVQHKLAHLRDKRTGPKDFRELAEEVAMLMAYEAMRDLELEETTVETPI--APARVKVLSGKKLALVAILRAGLVMVEGILKLVPHARVGHIGLY----------------QYYIKLPPDIAERR--AFLLDPMLATGGSASLALSLLKERG--A--TGVK--LMAILAAPEGLERIAKDHPDTEVVVAAIDERLNDHGYIVPGLGDAGDRIYGTK
3 PsiBlast_PDB 87.8856%-147 - C6 -1V9S UPP_THET2 A:[2-208] --RITLVDHPLVQHKLAHLRDKRTGPKDFRELAEEVAMLMAYEAMRDLELEETTVETPI--APARVKVLSGKKLALVAILRAGLVMVEGILKLVPHARVGHIGLY----------------QYYIKLPPDIAERR--AFLLDPMLATGGSASLALSLLKERG--A--TGVK--LMAILAAPEGLERIAKDHPDTEVVVAAIDERLNDHGYIVPGLGDAGDRIYGTK
4 PsiBlast_PDB 87.8555%-143 - C6 -1O5O UPP_THEMA A:[13-221] MKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRHLKCEEVEVETPI--TKTIGYRINDKDIVVVPILRAGLVMADGILELLPNASVGHIGIYRDP-------ETLQAVEYYAKLPPLNDDKE--VFLLDPMLATGVSSIKAIEILKENG--A--KKIT--LVALIAAPEGVEAVEKKYEDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK
23 PsiBlast_CBE 87.7355%-140 - C6 -1O5O UPP_THEMA C:[13-221] MKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRHLKCEEVEVETPI--TKTIGYRINDKDIVVVPILRAGLVMADGILELLPNASVGHIGIYRDP-------ETLQAVEYYAKLPPLNDDKE--VFLLDPMLATGVSSIKAIEILKENG--A--KKIT--LVALIAAPEGVEAVEKKYEDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK
67 HHSearch 87.1955%-142 - C6 -1O5O UPP_THEMA A:[14-221] -KNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRHLKCEEVEVETPI--TKTIGYRINDKDIVVVPILRAGLVMADGILELLPNASVGHIGIYRDP-------ETLQAVEYYAKLPPLNDDKE--VFLLDPMLATGVSSIKAIEILKENG--A--KKIT--LVALIAAPEGVEAVEKKYEDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK
63 HHSearch 87.1853%-134 - C6 -2EHJ UPP_ECOLI A:[1-208] -KKIVEVKHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWN--GPVEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNE-------ETLEPVPYFQKLVSNIDERM--ALIVDPMLATGGSVIATIDLLKKAG--C--SSIK--VLVLVAAPEGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK
24 PsiBlast_CBE 86.9955%-142 - C6 -1O5O UPP_THEMA B:[13-221] MKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRHLKCEEVEVETPI--TKTIGYRINDKDIVVVPILRAGLVMADGILELLPNASVGHIGIYRDP-------ETLQAVEYYAKLPPLNDDKE--VFLLDPMLATGVSSIKAIEILKENG--A--KKIT--LVALIAAPEGVEAVEKKYEDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK
22 PsiBlast_CBE 86.8255%-144 - C6 -1O5O UPP_THEMA D:[13-221] MKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRHLKCEEVEVETPI--TKTIGYRINDKDIVVVPILRAGLVMADGILELLPNASVGHIGIYRDP-------ETLQAVEYYAKLPPLNDDKE--VFLLDPMLATGVSSIKAIEILKENG--A--KKIT--LVALIAAPEGVEAVEKKYEDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK
5 PsiBlast_PDB 86.4454%-133 - C6 -2EHJ UPP_ECOLI A:[6-208] ------VKHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWN--GPVEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNE-------ETLEPVPYFQKLVSNIDERM--ALIVDPMLATGGSVIATIDLLKKAG--C--SSIK--VLVLVAAPEGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK
27 PsiBlast_CBE 86.2954%-134 - C6 -2EHJ UPP_ECOLI B:[6-208] ------VKHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWN--GPVEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNE-------ETLEPVPYFQKLVSNIDERM--ALIVDPMLATGGSVIATIDLLKKAG--C--SSIK--VLVLVAAPEGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK
26 PsiBlast_CBE 86.2054%-135 - C6 -2EHJ UPP_ECOLI C:[6-208] ------VKHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWN--GPVEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNE-------ETLEPVPYFQKLVSNIDERM--ALIVDPMLATGGSVIATIDLLKKAG--C--SSIK--VLVLVAAPEGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK
25 PsiBlast_CBE 84.9354%-132 - C6 -2EHJ UPP_ECOLI D:[6-208] ------VKHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWN--GPVEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNE-------ETLEPVPYFQKLVSNIDERM--ALIVDPMLATGGSVIATIDLLKKAG--C--SSIK--VLVLVAAPEGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK
66 HHSearch 79.5537%-137 - C6 -2E55 UPP_AQUAE A:[1-206] --MIVELSHPLIKHKVNTARIQDTSAEKLRKTLKELGFMLVYEALKDILLEEKEVRTWI--GNKRFNYLNEEEIVFVPILRAGLSFLEGALQVVPNAKVGFLGIKRNE-------ETLESHIYYSRLP-ELKGKI--VVILDPMLATGGTLEVALREILKHS--P--LKVK--SVHAIAAPEGLKRIEEKFKEVEIFVGNVDERLNDKGYIIPGLGDIGDRLYAVS
28 PsiBlast_CBE 78.5337%-138 - C6 -2E55 UPP_AQUAE D:[5-205] ------LSHPLIKHKVNTARIQDTSAEKLRKTLKELGFMLVYEALKDILLEEKEVRTWI--GNKRFNYLNEEEIVFVPILRAGLSFLEGALQVVPNAKVGFLGIKRNE-------ETLESHIYYSRLP-ELKGKI--VVILDPMLATGGTLEVALREILKHS--P--LKVK--SVHAIAAPEGLKRIEEKFKEVEIFVGNVDERLNDKGYIIPGLGDIGDRLYAV-
6 PsiBlast_PDB 78.3437%-139 - C6 -2E55 UPP_AQUAE A:[5-205] ------LSHPLIKHKVNTARIQDTSAEKLRKTLKELGFMLVYEALKDILLEEKEVRTWI--GNKRFNYLNEEEIVFVPILRAGLSFLEGALQVVPNAKVGFLGIKRNE-------ETLESHIYYSRLP-ELKGKI--VVILDPMLATGGTLEVALREILKHS--P--LKVK--SVHAIAAPEGLKRIEEKFKEVEIFVGNVDERLNDKGYIIPGLGDIGDRLYAV-
43 PsiBlast_CBE 76.9834%-129 - C6 -1UPU UPP_TOXGO C:[29-223] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
16 PsiBlast_PDB 76.0930%-135 - C6 -1VST UPP_SULSO A:[3-216] ---LYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIP-DIRAKVDNVIIADPMIATASTMLKVLEEVVKAN--P--KRIY--IVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG--
46 PsiBlast_CBE 75.8834%-129 - C6 -1UPF UPP_TOXGO C:[29-223] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
48 PsiBlast_CBE 75.6834%-127 - C6 -1UPF UPP_TOXGO A:[29-223] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
17 PsiBlast_PDB 75.5030%-136 - C6 -3G6W UPP_SULSO A:[3-216] ---LYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIP-DIRAKVDNVIIADPMIATASTMLKVLEEVVKAN--P--KRIY--IVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG--
37 PsiBlast_CBE 75.3134%-131 - C6 -1BD4 UPP_TOXGO C:[48-242] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
47 PsiBlast_CBE 75.2934%-127 - C6 -1UPF UPP_TOXGO B:[29-223] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
11 PsiBlast_PDB 75.2434%-132 - C6 -1UPU UPP_TOXGO D:[29-223] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
39 PsiBlast_CBE 75.1734%-127 - C6 -1BD4 UPP_TOXGO A:[48-242] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
32 PsiBlast_CBE 74.9234%-126 - C6 -1JLS UPP_TOXGO C:[48-242] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
45 PsiBlast_CBE 74.8934%-123 - C6 -1UPU UPP_TOXGO A:[29-223] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
31 PsiBlast_CBE 74.7134%-133 - C6 -1JLS UPP_TOXGO D:[48-242] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRD-----------EPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
44 PsiBlast_CBE 74.5634%-127 - C6 -1UPU UPP_TOXGO B:[29-223] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDE-------TTAEPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT-
33 PsiBlast_CBE 74.3734%-131 - C6 -1JLS UPP_TOXGO A:[48-242] ---------------MTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPL--DVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRD-----------EPKLIYEKLPADIRERW--VMLLDPMCATAGSVCKAIEVLLRLG--V--KEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYY