@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2556: (2016-04-04 )
MPIVNMTDMLKKALAGKYAVGQFNINNLEWTQAILKAAEAEKAPVILGVSEGAAKYMGGFKTVVKMTEGLVEDLKITVPVAIHLDHGSSFDSCKAAIDAGFSSVMIDGSHHPIDENIAMTKQVVDYAHAKGVSVEAEIGTVGGDEDGVTGGINYADPQECLRVVKEANIDALAAALGSVHGPYHGEPVLGFDEMKEISELTGAPLVLHGGSGIPEHQIKKAIELGHSKINVNTECQIVWTAAVREKLATDDKVYDPRKVIGPGVDAIIKTVTEKIQEFGSNGKA

Atome Classification :

(27 SA) --.....---....10........20........30........40........50.......--.---60..-------......70.---..-.....80......-----------..90.--------------.......100.......110.......120.......130.......140.......150..--..---....160.....-----..170.......180-..----.-.--.--...190.......-----------200.--......210--------------------...---------------------.---------------------.---------------------...220.......230.......240.......250------------.-.-......260.......270.......280..-
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --MPIVN---MTDMLKKALAGKYAVGQFNINNLEWTQAILKAAEAEKAPVILGVSEGAAKYMG--G---FKTV-------VKMTEGLVE---DL-KITVPVAIHLDHG-----------SSFDS--------------CKAAIDAGFSSVMIDGSHHPIDENIAMTKQVVDYAHAKGVSVEAEIGTVGGDEDGVTG-GIN--YA---DPQECLRVVKEA-----NIDALAAALGSVHG--PY----H-G--E--PVLGFDEMKEISE-----------LTGA--PLVLHGGS---------------------GIP---------------------E---------------------H---------------------QIKKAIELGHSKINVNTECQIVWTAAVREKLATDD-------------K-V-YDPRKVIGPGVDAIIKTVTEKIQEFGSNGKA-
1 PsiBlast_PDB 97.7867% -89 - C2 -3Q94 ? A:[5-288] ---PLVS---MKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMT--G---FKTV-------VAMVKALIE---EM-NITVPVAIHLDHG-----------SSFEK--------------CKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVI--YA---DPAECKHLVEAT-----GIDCLAPALGSVHG--PY----K-G--E--PNLGFAEMEQVRD-----------FTGV--PLVLHGGT---------------------GIP---------------------T---------------------A---------------------DIEKAISLGTSKINVNTENQIEFTKAVREVLNKDQ-------------E-V-YDPRKFIGPGRDAIKATVIGKIREFGSNGKA-
2 PsiBlast_PDB 93.3865% -94 - C2 -4TO8 ? A:[2-285] ---PLVS---MKEMLIDAKENGYAVGQYNINNLEFTQAILEASQEENAPVILGVSEGAARYMS--G---FYTI-------VKMVEGLMH---DL-NITIPVAIHLDHG-----------SSFEK--------------CKEAIDAGFTSVMIDASHSPFEENVATTKKVVEYAHEKGVSVEAELGTVGG--DDVVADGII--YA---DPKECQELVEKT-----GIDALAPALGSVHG----------------PKLGFKEMEEIGL-----------STGL--PLVLHGGT---------------------GIP---------------------T---------------------K---------------------DIQKAIPFGTAKINVNTENQIASAKAVRDVLNNDK-------------E-V-YDPRKYLGPAREAIKETVKGKIKEFGTSNRA-
21 PsiBlast_CBE 92.7665% -93 - C2 -4TO8 ? B:[2-285] ---PLVS---MKEMLIDAKENGYAVGQYNINNLEFTQAILEASQEENAPVILGVSEGAARYMS--G---FYTI-------VKMVEGLMH---DL-NITIPVAIHLDHG-----------SSFEK--------------CKEAIDAGFTSVMIDASHSPFEENVATTKKVVEYAHEKGVSVEAELGTVGG--DDVVADGII--YA---DPKECQELVEKT-----GIDALAPALGSVH-----------------PKLGFKEMEEIGL-----------STGL--PLVLHGGT---------------------GIP---------------------T---------------------K---------------------DIQKAIPFGTAKINVNTENQIASAKAVRDVLNNDK-------------E-V-YDPRKYLGPAREAIKETVKGKIKEFGTSNRA-
53 HHSearch 84.0847% -82 * C2 *2ISW ? A:[2-307] ---PLCT---LRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKYSD------MIYL-------KKLCEAA-----LEKHPDIPICIHLDHG-----------DTLES--------------VKMAIDLGFSSVMIDASHHPFDENVRITKEVVAYAHARSVSVEAELGTL-----------VQ--LT---EPQDAKKFVELT-----GVDALAVAIGTSHG--AY----KFKS-----RLAIDRVKTISD-----------LTGI--PLVMHGSSSVPKDVKDMINKYGGKMPDAVGVP---------------------I---------------------E---------------------SIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHP-------------E-K-FDPRDYLGPGRDAITEMLIPKIKAFGSAGHA-
4 PsiBlast_PDB 83.8243% -83 - C2 -2ISV ? A:[2-307] ---PLCT---LRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKY-S--D---MIYL-------KKLCEAALE---K--HPDIPICIHLDHG-----------DTLES--------------VKMAIDLGFSSVMIDASHHPFDENVRITKEVVAYAHARSVSVEAELG-----------------LT---EPQDAKKFVELT-----GVDALAVAIGTSHG--A--------------RLAIDRVKTISD-----------LTGI--PLVMHGSSSVPKDVKDMINKYGGKMPDAVGVP---------------------I---------------------E---------------------SIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHP-------------E-K-FDPRDYLGPGRDAITEMLIPKIKAFGSAGHA-
5 PsiBlast_PDB 83.1543% -82 - C2 -2ISW ? A:[2-307] ---PLCT---LRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKY-S--D---MIYL-------KKLCEAALE---K--HPDIPICIHLDHG-----------DTLES--------------VKMAIDLGFSSVMIDASHHPFDENVRITKEVVAYAHARSVSVEAELGTL-----------VQ--LT---EPQDAKKFVELT-----GVDALAVAIGTSHG--AYKFKS---------RLAIDRVKTISD-----------LTGI--PLVMHGSSSVPKDVKDMINKYGGKMPDAVGVP---------------------I---------------------E---------------------SIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHP-------------E-K-FDPRDYLGPGRDAITEMLIPKIKAFGSAGHA-
22 PsiBlast_CBE 83.1143% -86 - C2 -3GAK ? B:[2-307] ---PLCT---LRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKY-S--D---MIYL-------KKLCEAALE---K--HPDIPICIHLDHG-----------DTLES--------------VKMAIDLGFSSVMIDASHHPFDENVRITKEVVAYAHARGVSVEAELG------------------T---EPQDAKKFVELT-----GVDALAVAIGTSHG--AYKFKSE---------LAIDRVKTISD-----------LTGI--PLVMHGSSSVPKDVKDMINKYGGKMPDAVGVP---------------------I---------------------E---------------------SIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHP-------------E-K-FDPRDYLGPGRDAITEMLIPKIKAFGSAGHA-
23 PsiBlast_CBE 82.9843% -83 - C2 -2ISV ? B:[2-307] ---PLCT---LRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKY-S--D---MIYL-------KKLCEAALE---K--HPDIPICIHLDHG-----------DTLES--------------VKMAIDLGFSSVMIDASHHPFDENVRITKEVVAYAHARSVSVEAELG---------QN-TVQ--LT---EPQDAKKFVELT-----GVDALAVAIGTSHG--AYKF----------IRLAIDRVKTISD-----------LTGI--PLVMHGSSSVPKDVKDMINKYGGKMPDAVGVP---------------------I---------------------E---------------------SIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHP-------------E-K-FDPRDYLGPGRDAITEMLIPKIKAFGSAGHA-
55 HHSearch 82.2845% -78 - C2 -1RVG ? A:[1-305] ---MLVT---GLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGG-------RAL-------TLMAVEL-----AK-EARVPVAVHLDHG-----------SSYES--------------VLRALRAGFTSVMIDKSHEDFETNVRETRRVVEAAHAVGVTVEAELGRLAGIEE---K-DAL--LT---NPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-GKGR--PFIDHARLERIAR-----------LVPA--PLVLHGASAVPPELVERFRASGGEIGEAAGIH---------------------P---------------------E---------------------DIKKAISLGIAKINTDTDLRLAFTALIREALNKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
6 PsiBlast_PDB 81.4940% -83 - C2 -1RV8 ? A:[2-305] ----LVT---GLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGG-------RAL-------TLMAVELAK---EA-R--VPVAVHLDHG-----------SSYES--------------VLRALRAGFTSVMIDKSHEDFETNVRETRRVVEAAHAVGVTVEAELGRLAGI---------K--DALLTNPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-G--KGRPFIDHARLERIAR-----------LVPA--PLVLHGAS---------------------AVPPELVERFRASGGEIGEAAGIHP---------------------E---------------------DIKKAISLGIAKINTDTDLRLAFTALIREALNKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
8 PsiBlast_PDB 81.0841% -79 - C2 -2FJK ALF_THECA A:[2-305] ----LVT---GLEILRKARAEGYGVGAFNTNNMEFTQAILEAAEEMKSPVILALSEGAMKYGG-------RAL-------TRMVVALAQ---EA-R--VPVAVHLDHG-----------SSYES--------------VLKALREGFTSVMIDKSHEDFETNVRETKRVVEAAHAVGVTVEAELGRLAGIEEHVAV-DEK--DALLTNPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-G--KGRPFIDHPRLARIAK-----------LVPA--PLVLHGAS---------------------AVP---------------------QELVERFRAAGGEIGEASGIHPE---------------------DIKKAISLGIAKINTDTDLRLAFTALVRETLGKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
54 HHSearch 80.8539% -85 - C2 -1GVF KBAY_ECOLI A:[2-284] ---SIIS---TKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIA------LEEI-------YALCSAY-----ST-TYNMPLALHLDHH-----------ESLDD--------------IRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLG---------SAF--LT---DPQEAKRFVELT-----GVDSLAVAIGTAHG--LY----S-K--T--PKIDFQRLAEIRE-----------VVDV--PLVLHGAS---------------------DVP---------------------D---------------------E---------------------FVRRTIELGVTKVNVATELKIAFAGAVKAWFAENP-------------Q-G-NDPRYYMRVGMDAMKEVVRNKINVCGSANRI-
3 PsiBlast_PDB 80.6743% -84 - C2 -3GAK ? A:[2-307] ---PLCT---LRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKY-S--D---MIYL-------KKLCEAALE---K--HPDIPICIHLDHG-----------DTLES--------------VKMAIDLGFSSVMIDASHHPFDENVRITKEVVAYAHARGVSVEAELG------------------T---EPQDAKKFVELT-----GVDALAVAI-----------------------LAIDRVKTISD-----------LTGI--PLVMHGSSSVPKDVKDMINKYGGKMPDAVGVP---------------------I---------------------E---------------------SIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHP-------------E-K-FDPRDYLGPGRDAITEMLIPKIKAFGSAGHA-
28 PsiBlast_CBE 80.5740% -80 - C2 -1RV8 ? C:[2-305] ----LVT---GLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGG-------RAL-------TLMAVELAK---EA-R--VPVAVHLDHG-----------SSYES--------------VLRALRAGFTSVMIDKSHEDFETNVRETRRVVEAAHAVGVTVEAELGRLAGIEEHVAV-DEK--DALLTNPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-G--KGRPFIDHARLERIAR-----------LVPA--PLVLHGAS---------------------AVPPELVERFRASGGEIGEAAGIHP---------------------E---------------------DIKKAISLGIAKINTDTDLRLAFTALIREALNKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
26 PsiBlast_CBE 80.5440% -82 - C2 -1RVG ? B:[2-305] ----LVT---GLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGG-------RAL-------TLMAVELAK---EA-R--VPVAVHLDHG-----------SSYES--------------VLRALRAGFTSVMIDKSHEDFETNVRETRRVVEAAHAVGVTVEAELGRLAGIEEHVAV-DEK--DALLTNPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-G--KGRPFIDHARLERIAR-----------LVPA--PLVLHGAS---------------------AVPPELVERFRASGGEIGEAAGIHP---------------------E---------------------DIKKAISLGIAKINTDTDLRLAFTALIREALNKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
25 PsiBlast_CBE 80.4840% -82 - C2 -1RVG ? C:[2-305] ----LVT---GLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGG-------RAL-------TLMAVELAK---EA-R--VPVAVHLDHG-----------SSYES--------------VLRALRAGFTSVMIDKSHEDFETNVRETRRVVEAAHAVGVTVEAELGRLAGIEEHVAV-DEK--DALLTNPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-G--KGRPFIDHARLERIAR-----------LVPA--PLVLHGAS---------------------AVPPELVERFRASGGEIGEAAGIHP---------------------E---------------------DIKKAISLGIAKINTDTDLRLAFTALIREALNKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
31 PsiBlast_CBE 80.3838% -81 - C2 -3N9R ? Z:[2-306] ----LVK---GNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMG-----------------IDMAVGMVKIMCER-YPHIPVALHLDHG-----------TTFES--------------CEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGI-------------AVLVNPKEAEQFVKES-----QVDYLAPAIGTSHGAFKF----K-G--E--PKLDFERLQEVKR-----------LTNI--PLVLHGAS---------------------AIP---------------------D---------------------NVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVR-KVANED-------------K-SQFDLRKFFSPAQLALKNVVKERMKLLGSANK--
24 PsiBlast_CBE 80.2140% -79 - C2 -1RVG ? D:[2-305] ----LVT---GLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGG-------RAL-------TLMAVELAK---EA-R--VPVAVHLDHG-----------SSYES--------------VLRALRAGFTSVMIDKSHEDFETNVRETRRVVEAAHAVGVTVEAELGRLAGIEEHVAV-DEK--DALLTNPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-G--KGRPFIDHARLERIAR-----------LVPA--PLVLHGAS---------------------AVPPELVERFRASGGEIGEAAGIHP---------------------E---------------------DIKKAISLGIAKINTDTDLRLAFTALIREALNKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
7 PsiBlast_PDB 80.2140% -81 - C2 -1RVG ? A:[2-305] ----LVT---GLEILKKAREEGYGVGAFNVNNMEFLQAVLEAAEEQRSPVILALSEGAMKYGG-------RAL-------TLMAVELAK---EA-R--VPVAVHLDHG-----------SSYES--------------VLRALRAGFTSVMIDKSHEDFETNVRETRRVVEAAHAVGVTVEAELGRLAGIEE-------K--DALLTNPEEARIFMERT-----GADYLAVAIGTSHG--AY----K-G--KGRPFIDHARLERIAR-----------LVPA--PLVLHGAS---------------------AVPPELVERFRASGGEIGEAAGIHP---------------------E---------------------DIKKAISLGIAKINTDTDLRLAFTALIREALNKNP-------------K-E-FDPRKYLGPAREAVKEVVKSRMELFGSVGRA-
32 PsiBlast_CBE 80.1338% -80 - C2 -3N9R ? U:[2-306] ----LVK---GNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMG-----------------IDMAVGMVKIMCER-YPHIPVALHLDHG-----------TTFES--------------CEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGI-------------AVLVNPKEAEQFVKES-----QVDYLAPAIGTSHGAFKF----K-G--E--PKLDFERLQEVKR-----------LTNI--PLVLHGAS---------------------AIP---------------------D---------------------NVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVR-KVANED-------------K-SQFDLRKFFSPAQLALKNVVKERMKLLGSANK--