@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo2676: (2016-04-06 )
VRHVVIFCASILNRFFASVECVKRRLNPLEAYLVVMSNAERAGGLVLAATPKMKQEHHIKTGSRMYELPTWDKRIIIAPPRMKLYLKVNAMIQAIFRRYVPAEFIHVYSIDECFLDVTGSHLLFGSTEEIVRKIQRDILEELRLYVTVGIGDNPLLAKLALDNVAKNRDDGIAEWRYEHVPETIWKIRHLDDVCGIGRRTAVRLQKMGIFNMYQLSQTPPQVLKNVMGVVGEQLYYHAHGIDYSLLNEKYVPVSKSYGKSQILEKDYHVPAEVEIVIREMVEEVAMRLRQNHVDTAVIHLSVGYSKYSIKKGFSHQAKIPPTSSSHALIPYFLQLFRRYDEREPVRSIAISCGKITLKTGLQLNLFEDFTQTLNHEQLEITVDKIRSRYGFKSLMHASSLLNGATGLKRSEMVGGHKG

Atome Classification :

(20 SA) ------------------------------------------------------------------.........10........20........----30........40------------------------------........50--........60........70........80........90.-.......100.......110.......120.--------------------..-....130.......140.......150.......160-.......170.......180.......190-........200.......210.......220...-....-230.......240.......250........260-.......270.......280.......290----........300......------------.310.......320........330.......340.--.......350.......360.......370.......380.......390.......400.......410......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------------------------------------------------------------------VRHVVIFCASILNRFFASVECVKRRLNPL----EAYLVVMSNAER------------------------------AGGLVLAATP--KMKQEHHIKTGSRMYELPTWDKRIIIAPPRMKLYLKVNAMI-QAIFRRYVPAEFIHVYSIDECFLDVTGSHLL--------------------FG-STEEIVRKIQRDILEELRLYVTVGIGDNPLLAKLALD-NVAKNRDDGIAEWRYEHVPETIWKIRHLD--DVCGIGRRTAVRLQKMGIFNMYQLSQTPPQVLKN-VMGV-VGEQLYYHAHGIDYSLLNEKY-VPVSKSYGKSQI-LEKDYHVPAEVEIVIREMVEEVAMRLRQN-----HVDTAVIHLSVGYSKYS------------IKKGFSHQAKIPP-TSSSHALIPYFLQLFRRYDE-R--EPVRSIAISCGKITLKTGLQLNLFEDFTQTLNHEQLEITVDKIRSRYGFKSLMHASSLLNGATGLKRSEMVGGHKG
16 PsiBlast_PDB 90.4626%-132 - C2 -2ASD DPO4_SULSO A:[10-349] ---------------------------------------------------------------------IVLFVD--FDYFYAQVEEV---LNPSLKGKPVVVCVFSGRFE------------------------------DSGAVATANY--EARK-FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRI-MNLLREY--SEKIEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAAD-MAKPN---GIKVIDDEEVKRL---IRELDIADVPGIGNITAEKLKKLGI---NKLVDTLSIEFDK-LKGM-IGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT-MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT------------FPHGISKE------TAYSESV--KLLQKILEEDE-R--K-IRRIGVRFSKFI--------------------------------------------------------------
19 PsiBlast_PDB 89.9326%-132 - C2 -2ATL DPO4_SULSO A:[10-349] ---------------------------------------------------------------------IVLFVD--FDYFYAQVEEV---LNPSLKGKPVVVCVFSGRFE------------------------------DSGAVATANY--EARK-FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRI-MNLLREY--SEKIEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAAD-MAKPN---GIKVIDDEEVKRL---IRELDIADVPGIGNITAEKLKKLGI---NKLVDTLSIEFDK-LKGM-IGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT-MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT------------FPHGISKE------TAYSESV--KLLQKILEEDE-R--K-IRRIGVRFSKFI--------------------------------------------------------------
18 PsiBlast_PDB 89.5226%-130 - C2 -2ASL DPO4_SULSO A:[10-349] ---------------------------------------------------------------------IVLFVD--FDYFYAQVEEV---LNPSLKGKPVVVCVFSGRFE------------------------------DSGAVATANY--EARK-FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRI-MNLLREY--SEKIEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAAD-MAKPN---GIKVIDDEEVKRL---IRELDIADVPGIGNITAEKLKKLGI---NKLVDTLSIEFDK-LKGM-IGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT-MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT------------FPHGISKE------TAYSESV--KLLQKILEEDE-R--K-IRRIGVRFSKFI--------------------------------------------------------------
20 PsiBlast_PDB 88.8426%-124 - C2 -2AU0 DPO4_SULSO A:[10-349] ---------------------------------------------------------------------IVLFVD--FDYFYAQVEEV---LNPSLKGKPVVVCVFSGRFE------------------------------DSGAVATANY--EARK-FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRI-MNLLREY--SEKIEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAAD-MAKPN---GIKVIDDEEVKRL---IRELDIADVPGIGNITAEKLKKLGI---NKLVDTLSIEFDK-LKGM-IGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT-MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT------------FPHGISKE------TAYSESV--KLLQKILEEDE-R--K-IRRIGVRFSKFI--------------------------------------------------------------
17 PsiBlast_PDB 87.7726%-126 - C2 -2ASJ DPO4_SULSO A:[10-349] ---------------------------------------------------------------------IVLFVD--FDYFYAQVEEV---LNPSLKGKPVVVCVFSGRFE------------------------------DSGAVATANY--EARK-FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRI-MNLLREY--SEKIEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAAD-MAKPN---GIKVIDDEEVKRL---IRELDIADVPGIGNITAEKLKKLGI---NKLVDTLSIEFDK-LKGM-IGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT-MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT------------FPHGISKE------TAYSESV--KLLQKILEEDE-R--K-IRRIGVRFSKFI--------------------------------------------------------------
11 PsiBlast_PDB 86.6126%-130 - C- -2UVR DPO4_SULSO A:[8-348] ---------------------------------------------------------------------IVLFVD--FDYFYAQVEEV---LNPSLKGKPVVVCVFSGRFE------------------------------DSGAVATANY--EARK-FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRI-MNLLREY--SEKIEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAAD-MAKPN---GIKVIDDEEVKRL---IRELDIADVPGIGNITAEKLKKLGI---NKLVDTLSIEFDK-LKGM-IGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT-MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT------------FPHGISKE------TAYSESV--KLLQKILEEDE-R--K-IRAIGVRFSKFIE-------------------------------------------------------------
14 PsiBlast_PDB 86.2426%-129 - C- -2UVW DPO4_SULSO A:[8-348] ---------------------------------------------------------------------IVLFVD--FDYFYAQVEEV---LNPSLKGKPVVVCVFSGRFE------------------------------DSGAVATANY--EARK-FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRI-MNLLREY--SEKIEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAAD-MAKPN---GIKVIDDEEVKRL---IRELDIADVPGIGNITAEKLKKLGI---NKLVDTLSIEFDK-LKGM-IGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT-MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRT------------FPHGISKE------TAYSESV--KLLQKILEEDE-R--K-IREIGVRFSKFIE-------------------------------------------------------------
9 PsiBlast_PDB 84.5527%-106 - C2 -4Q45 DPO4_ECOLI F:[10-281] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALALCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPD--------------------------------------------------------------------------------------------------------------------------------------------
49 Fugue 84.4522%-121 * C2 *1JX4 DPO4_SULSO A:[2-341] -----------------------------------------------------------------------IVLFVDFDYFYAQVEEVLNPSLKG----KPVVVCVFSGRF------------------------------EDSGAVATAN--YEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMN-LLREYSEK--IEIASIDEAYLDISDKVRD--------------------YR-EAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMA----KPNGIKVIDDEEVKRLIRELD-IA--DVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEA-KAKYLISLARDEYNEPIRTR----VRKSIGRIVTMKRNSRN-LEEIKPYLFRAIEESYYKLDKR-----IPKAIHVVAVT-----E------------DLDIVSRGRTFPH-GISKETAYSESVKLLQKILE-EDERKIRRIGVRFSKFI--------------------------------------------------------------
2 PsiBlast_PDB 84.4427%-109 - C2 -4IR1 DPO4_ECOLI F:[10-289] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALKLCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPDLLIARQGV------------------------------------------------------------------------------------------------------------------------------------
21 HHSearch 84.4119%-111 - C2 -3GQC - REV1_HUMAN A:[416-828] --------------------------------------------------------------------QSCIMHVD-MDCFFVSVGIRNRPDL-K----GKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGIDSVLSRAEIASCSY--EAR-QLGIKNGMFFGHAKQLCPNLQAVPYDFHAYKEVAQTL-YETLASYTHNI--EAVSCDEALVDITEILAE--------------------TKLTPDEFANAVRMEIKDQTKCAASVGIGSNILLARMATR-KA---KPDGQYHLKPEEVDDFIRGQ-LVT--NLPGVGHSMESKLASLGIKTCGDLQYMTMAKLQK-EFGPKTGQMLYRFCRGLDDRPVRTEK---ERKSVSAEIN-YGIRFTQPKEAEAFLLSLSEEIQRRLEAT-----GMKGKRLTLKIMVRKPGAPVETAKFGGHGICDNIARTVTLDQATDNAKIIGKAMLNMFHTMKLNI--SDMRGVGIHVNQLVPTN-----------------------------------------------------------
6 PsiBlast_PDB 84.0227%-111 - C2 -4IRD DPO4_ECOLI F:[10-281] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALALCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPD--------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 83.7427%-115 - C2 -4IRK DPO4_ECOLI B:[10-281] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALALCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPD--------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 83.7027%-111 - C2 -4R8U ? B:[8-279] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALKLCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPD--------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 83.5227%-109 - C2 -4IR9 DPO4_ECOLI F:[10-289] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALKLCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPDLLIARQGV------------------------------------------------------------------------------------------------------------------------------------
55 Fugue 83.2617%-115 - C2 -2W7O POLK_HUMAN A:[15-501] KEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHI--DMDAFYAAVEMRDNP--EL----KDKPIAVGSM----------------------------------SMLSTSNY--HARR-FGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEV-KEILADYDP--NFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKQNSVVFGT-SAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSD-KNKPNGQYQILP-NRQAVMDFIKDLP-IR--KVSGIGKVTEKMLKALGIITCTELYQQRALLSLL-FSET-SWHYFLHISLGLGSTHLTRDG-ERKSMSVERTFS-EINK---AEEQYSLCQELCSELAQDLQKE-----RLKGRTVTIKLKNVNFE------------VKTRASTVSSVV---STAEEIFAIAKELLKTEID-A--DFPHPLRLRLMGVRIS-----------------------------------------------SFPNE--------
8 PsiBlast_PDB 83.0627%-113 - C2 -4Q44 DPO4_ECOLI A:[10-281] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALALCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPD--------------------------------------------------------------------------------------------------------------------------------------------
54 Fugue 83.0316%-110 - C2 -2OH2 POLK_HUMAN A:[15-499] KEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHI--DMDAFYAAVEMRDNPELKD----KPIAV------G------------------------------SMSMLSTSNY--HARR-FGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEV-KEILADYDP--NFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKNSVVF-GT-SAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSD-K-NKPNGQYQILPNRQAVMDFIKDLP-IR--KVSGIGKVTEKMLKALGIITCTELYQQRALLSLL-FSET-SWHYFLHISLGLGSTHLTRD---GERKSMSVERT-FSEINK-AEEQYSLCQELCSELAQDLQKE-----RLKGRTVTIKLKNVNFE------------VKT--RASTVSSV-VSTAEEIFAIAKELLKTEID-A--DFPHPLRLRLMGVRIS-------------------------------SFP--------------------------
5 PsiBlast_PDB 83.0227%-108 - C2 -4IRC DPO4_ECOLI F:[10-281] -----------------------------------------------------------------------------MDCFFAAVEM---RDNPALR--DIPIAIGGSRER------------------------------RGVISTANYPARKFGVRSAMPTGMALALCP----HLTLLPGRFDAYKEASNHI-REIFSRYT--SRIEPLSLDEAYLDVTDSVHC--------------------HG-SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASD----MNKPNGQFVITPAEVPAFLQTL-PLA--KIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLK-RFGK-FGRILWERSQGIDERDVNSER---LRKSVGVERT-MAEDIHHWSECEAIIERLYPELERRLAKV-----KPD--------------------------------------------------------------------------------------------------------------------------------------------