@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs0023: (2015-11-27 )
MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL

Atome Classification :

(29 SA) .....--....10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180--........190.......200.-...-.-..210.......220.......230..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNNQL--IYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGF---DKDGKIILADEFSPDNCRLWDA-EGN-H-MDKDVFRRDLGSLTDVYQVVLEKLIAL
2 PsiBlast_PDB 98.7979% -81 - C3 -4FGR PUR7_STRPN A:[21-254] MSKQL--IYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKDGKIILADEFSPDNCRLWDA-DGN-H-MDKDVFRRGLGELTDVYEIVWEKLQEL
3 PsiBlast_PDB 97.9379% -79 - C3 -4NYE PUR7_STRPN A:[21-254] MSKQL--IYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKDGKIILADEFSPDNCRLWDA-DGN-H-MDKDVFRRGLGELTDVYEIVWEKLQEL
1 PsiBlast_PDB 96.4179% -77 - C3 -4FE2 PUR7_STRPN A:[23-254] --KQL--IYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKDGKIILADEFSPDNCRLWDA-DGN-H-MDKDVFRRGLGELTDVYEIVWEKLQEL
23 PsiBlast_CBE 95.9579% -75 - C3 -4FE2 PUR7_STRPN B:[21-254] MSKQL--IYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKDGKIILADEFSPDNCRLWDA-DGN-H-MDKDVFRRGLGELTDVYEIVWEKLQEL
21 PsiBlast_CBE 93.9679% -78 - C3 -4NYE PUR7_STRPN B:[22-254] -SKQL--IYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKDGKIILADEFSPDNCRLWDA-DGN-H-MDKDVFRRGLGELTDVYEIVWEKLQEL
22 PsiBlast_CBE 93.7879% -78 - C3 -4FGR PUR7_STRPN B:[22-254] -SKQL--IYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKDGKIILADEFSPDNCRLWDA-DGN-H-MDKDVFRRGLGELTDVYEIVWEKLQEL
39 HHSearch 88.2157% -70 - C3 -2YWV ? A:[6-238] -KQQL--LYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFGR---TADGAILLADEISPDTCRLWDA-KTNEK-LDKDVFRRDLGSLTDAYEVILQRLGGE
24 PsiBlast_CBE 87.8857% -66 - C3 -2YWV ? B:[7-236] --QQL--LYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFGR---TADGAILLADEISPDTCRLWDA-KTN-EKLDKDVFRRDLGSLTDAYEVILQRLGGE
4 PsiBlast_PDB 87.5657% -71 - C3 -2YWV ? A:[7-236] --QQL--LYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFGR---TADGAILLADEISPDTCRLWDA-KTN-EKLDKDVFRRDLGSLTDAYEVILQRLGGE
16 PsiBlast_PDB 84.2945% -67 - C3 -2YZL PUR7_METJA A:[9-239] LKKQP--LYSGKAKSIYEIDDDKVL-IEFRDDITAG-GAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DREGNLLVADEISPDTMRLWDK-ETR-DVLDKDVFRKDLGDVIAKYRIVAERLGLL
7 PsiBlast_PDB 83.7348% -65 - C3 -4O7L PUR7_PYRHO A:[7-231] -------VYEGKAKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
40 HHSearch 83.6346% -73 * C3 *3U55 PUR7_PYRHO A:[12-233] ------------AKKMIPID-DDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGI-SLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTKRS-LDKDVFRFDKGDLIEAYKEIYERITGE
6 PsiBlast_PDB 82.7748% -71 - C3 -3U55 PUR7_PYRHO A:[12-231] ------------AKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
27 PsiBlast_CBE 82.4843% -74 - C3 -3KRE PUR7_EHRCR A:[26-260] ---EK--IYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEFGKLHNDEQSDLFLADEISPDTCRLWDI-STNKR-LDKDRYRLNLGNVIEGYREVAHKLNAI
10 PsiBlast_PDB 82.4248% -81 - C3 -4O7S PUR7_PYRHO A:[15-231] ---------------MIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
13 PsiBlast_PDB 82.3448% -67 - C3 -4O7W PUR7_PYRHO A:[7-231] -------VYEGKAKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
25 PsiBlast_CBE 82.1751% -61 - C3 -3NUA PUR7_CLOP1 B:[4-236] MVNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG----RYNGEILLADEISPDTCRFWDATTGE-K-MDKDRFRRDMGNVINGYREVLNRLRN-
35 HHSearch 82.1145% -68 - C3 -2Z02 PUR7_METJA A:[10-242] -KKQP--LYSGKAKSIYEID-DDKVLIEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DREGNLLVADEISPDTMRLWDK-ETRDV-LDKDVFRKDLGDVIAKYRIVAERLGLL
8 PsiBlast_PDB 82.1048% -66 - C3 -4O7N PUR7_PYRHO A:[7-231] -------VYEGKAKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
14 PsiBlast_PDB 81.9748% -71 - C3 -4O7Y PUR7_PYRHO A:[11-231] -----------KAKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
11 PsiBlast_PDB 81.9248% -72 - C3 -4O7T PUR7_PYRHO A:[12-231] ------------AKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
26 PsiBlast_CBE 81.8645% -69 - C3 -2Z02 PUR7_METJA B:[9-239] LKKQP--LYSGKAKSIYEIDDDKVL-IEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DREGNLLVADEISPDTMRLWDK-ETR-DVLDKDVFRKDLGDVIAKYRIVAERLGLL
15 PsiBlast_PDB 81.8348% -73 - C3 -4O86 PUR7_PYRHO A:[12-231] ------------AKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
12 PsiBlast_PDB 81.7448% -70 - C3 -4O7V PUR7_PYRHO A:[11-231] -----------KAKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
19 PsiBlast_PDB 81.7048% -72 - C3 -4O81 PUR7_PYRHO A:[12-231] ------------AKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLD-EIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKNGDIVLADEISPDTCRFWDA-KTK-RSLDKDVFRFDKGDLIEAYKEIYERITGE
17 PsiBlast_PDB 81.6745% -69 - C3 -2Z02 PUR7_METJA A:[9-239] LKKQP--LYSGKAKSIYEIDDDKVL-IEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DREGNLLVADEISPDTMRLWDK-ETR-DVLDKDVFRKDLGDVIAKYRIVAERLGLL
5 PsiBlast_PDB 80.8451% -63 - C3 -3NUA PUR7_CLOP1 A:[4-236] MVNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG----RYNGEILLADEISPDTCRFWDATTGE