@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs0025: (2015-11-27 )
MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIVSNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFHDGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMHLIRRSHNPSFMGKVKEALSTVKGGFAYLLMTEDKLIAALDPNAFRPLSIGQMQNGAWVISSETCAFEVVGAKWVRDVEPGEVILIDDSGIQCDRYTDETQLAICSMEYVYFARPDSTIHGVNVHTARKNMGKRLAQEFKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMKLSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGIDIQTRRELISANHAADEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYPTPLYDYEEEYLRSLEEKTSFYIQKVK

Atome Classification :

(20 SA) .........10........20........30........40...-..-...-50........-.60........70........80........90........100...-....110.......120....-...-130.......140....--...-----150-------.........160..----.....170...-.---...180.......190....----..----.200.......210.....-------..220.....--------..230......-.---240....-...250.......260.......270.......280.-----.-----.....290.......300.......310.......320......--.330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGI-VS-NDN-G-KLYGYRNV-GLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFHD-GQFALCHNGNLTNAISLRKEL-EKQ-GAIFNASSDTEILMHLI--RRS-----H---------NPSFMGKVKEALST----VKGGFAYLLMT-E---DKLIAALDPNAFRPLSIGQM----QN----GAWVISSETCAFEVVGAKW-------VRDVEPGEVI--------LIDDSGIQCDR-Y---TDETQLA-ICSMEYVYFARPDSTIHGVNVHTARKNMGKRLAQEFK-----Q-----DADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQP--TQELREQGVRMKLSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGIDIQTRRELISANHAADEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYPTPLYDYEEEYLRSLEEKTSFYIQKVK
60 Fugue 99.2058%-105 - C6 -1AO0 PUR1_BACSU A:[1-459] -----------CGVFGIWGHEEAPQITYYGLHSLQHRGQEGAGI-VATDG--E-KLTAHKGQ-GLITEVFQNGEL-SKVKGKGAIGHVRYATG----YENVQPLLFRSQNNGSLALAHNGNLVNATQLKQQL-ENQ-GSIFQTSSDTEVLAHLI--KRS-----GHF---------TLKDQIKNSLSM----LKGAYAFLIMT-ET---EMIVALDPNGLRPLSIGMM----G-----DAYVVASETCAFDVVGATY-------LREVEPGEML--------IINDE-GMKSE-RFSM--NINRS-ICSMEYIYFSRPDSNIDGINVHSARKNLGKMLAQESA------V----EADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFI--QPSQALREQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHVKISSPPIAHPCFYGIDTSTHEELIASSHSVEEIRQEIGADTLSFLSVEGLLKGIGRKYDDSNCGQCLACFTGKYPTE-IYQDTV-LPHVK-----------
27 PsiBlast_CBE 88.3938% -95 - C6 -1ECB PUR1_ECOLI B:[1-478] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIM----------SVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFL------------
1 PsiBlast_PDB 88.1238% -97 - C6 -1ECF PUR1_ECOLI A:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
5 PsiBlast_PDB 87.8238% -93 - C6 -1ECJ PUR1_ECOLI A:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
2 PsiBlast_PDB 87.6738% -96 - C6 -1ECG PUR1_ECOLI A:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
21 PsiBlast_CBE 87.5038% -93 - C6 -1ECJ PUR1_ECOLI C:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
23 PsiBlast_CBE 86.9838% -93 - C6 -1ECF PUR1_ECOLI B:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
4 PsiBlast_PDB 86.9638% -88 - C6 -1ECC PUR1_ECOLI A:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
25 PsiBlast_CBE 86.8638% -98 - C6 -1ECB PUR1_ECOLI D:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIM----------SVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTL---------
24 PsiBlast_CBE 86.8638% -91 - C6 -1ECC PUR1_ECOLI B:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
22 PsiBlast_CBE 86.5638% -92 - C6 -1ECG PUR1_ECOLI B:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLRNDDAKAVQ
3 PsiBlast_PDB 85.9538% -92 - C6 -1ECB PUR1_ECOLI A:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--------KSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTL---------
38 HHSearch 85.8839% -93 * C6 *1ECF PUR1_ECOLI A:[1-489] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-NNCFRLRKAN-GLVSDVFEA-RHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSP--YGITLAHNGNLTNAHELRKKL-FEEKRRHINTTSDSEILLNIF--ASE-----LDNFRHYPLEADNIFAAIAATNRL----IRGAYACVAMI-IG--HGMVAFRDPNGIRPLVLGKR----DIDENRTEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTRQC---ADNPVSN-PCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIAREWEDL-----DIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRA-ENPDIQQFECSVFNGVYVTKDVDQGYLDF--LDTLRNDDAKAVQ
26 PsiBlast_CBE 84.4938% -94 - C6 -1ECB PUR1_ECOLI C:[1-479] -----------CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGI-IT-IDA-N-NCFRLRKANGLVSDVFEAR-HMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPY-G-ITLAHNGNLTNAHELRKKLFEEK-RRHINTTSDSEILLNIF--ASELDNFRH---------YPLEADNIFAAIAATNRLIRGAYACVAMIIG---HGMVAFRDPNGIRPLVLGKRDIDENR----TEYMVASESVALDTLGFDF-------LRDVAPGEAI--------YITEEGQLFTR-Q---CADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIA-----REWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMP--GQQLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFEC-SVFNGVYVTK--DVDQGYLDFLDTLR--------
40 HHSearch 57.1128%-100 - C6 -1XFF GLMS_ECOLI A:[1-222] -----------CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGL-AV-VDAEG-HMTRLRRL-GKVQMLAQA-AEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVS-----EHIVVVHNGIIENHEPLREEL-KAR-GYTFVSETDTEVIAHLV--NWELK---Q---------GGTLREAVLRAIPQ----LRGAYGTVIMD-SRHPDTLLAARSG---SPLVIGLG----M-----GENFIASDQLALLPV-TRR-------FIFLEEGDIA--------EITRRSVNIFD-K---TGAEVKR-QDIESNL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 56.1126%-108 - C6 -2J6H GLMS_ECOLI A:[1-238] -----------CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVV-DAE-G-HMTRLRRL-GKV-QMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSE-----HIVVVHNGIIENHEPLREEL-KAR-GYTFVSETDTEVIAHLVNWELK-----Q---------GGTLREAVLRAIPQ----LRGAYGTVIMD-SRHPDTLLAA---RSGSPLVIG-L----GM----GENFIASDQLALLPVTRRF-------IF-LEEGDIAEITRRSVNIFDKTGAEVKR-Q---DIESNLQ-YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQV-----D-----LSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIP--CDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYP
11 PsiBlast_PDB 55.9725%-107 - C6 -3OOJ GLMS_ECOLI A:[1-238] -----------AGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVV-DAE-G-HMTRLRRL-GKV-QMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSE-----HIVVVHNGIIENHEPLREEL-KAR-GYTFVSETDTEVIAHLVNWELK-----Q---------GGTLREAVLRAIPQ----LRGAYGTVIMD-SRHPDTLLAA---RSGSPLVIG-L----GM----GENFIASDQLALLPVTRRF-------IF-LEEGDIAEITRRSVNIFDKTGAEVKR-Q---DIESNLQ-YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQV-----D-----LSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIP--CDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYP
6 PsiBlast_PDB 54.9226%-110 - C6 -4AMV - GLMS_ECOLI A:[2-239] -----------CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVV-DAE-G-HMTRLRRL-GKV-QMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSE-----HIVVVHNGIIENHEPLREEL-KAR-GYTFVSETDTEVIAHLVNWELK-----Q---------GGTLREAVLRAIPQ----LRGAYGTVIMD-SRHPDTLLAA---RSGSPLVIG-L----GM----GENFIASDQLALLPVTRRF-------IF-LEEGDIAEITRRSVNIFDKTGAEVKR-Q---DIESNLQ-YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQV-----D-----LSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIP--CDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSKLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYP
9 PsiBlast_PDB 54.9025% -90 - C6 -1XFF GLMS_ECOLI A:[1-238] -----------CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVV-DAE-G-HMTRLRRL-GKV-QMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSE-----HIVVVHNGIIENHEPLREEL-KAR-GYTFVSETDTEVIAHLVNWELK-----Q---------GGTLREAVLRAIPQ----LRGAYGTVIMD-SRHPDTLLAA---RSGSPLVIG-L----GM----GENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVN--------IFDKTGAEVKR-Q---DIESNL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 54.8325% -89 - C6 -1XFG GLMS_ECOLI A:[1-238] -----------CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVV-DAE-G-HMTRLRRL-GKV-QMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSE-----HIVVVHNGIIENHEPLREEL-KAR-GYTFVSETDTEVIAHLVNWELK-----Q---------GGTLREAVLRAIPQ----LRGAYGTVIMD-SRHPDTLLA