@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs0029: (2015-11-27 )
MTKRALISVSDKSGIIDFAKELKNLGWDIISTGGTKVALDDAGVETIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDADSHLQAAKDNNIELIDLVVVNLYPFKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDSADYATVLGELADASQTTFKTRQRLAAKAFRHTAAYDALIAEYFTAQVGEAKPEKLTITYDLKQAMRYGENPQQDADFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDSPTVVALKHMNPCGIGQADDIETAWDYAYEADPVSIFGGIVVLNREVDAATAEKMHPIFLEIIIAPSYSEEALAILTNKKKNLRILELPFDAQAASEVEAEYTGVVGGLLVQNQDVVAENPSDWQVVTDRQPTEQEATALEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKDHLDGAVLASDAFFPFADNIEEIAAAGIKAIIQPGGSVRDQESIDAANKHGLTMIFTGVRHFRH

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.....--..--160.........170.......180.......----190....-----.-..200....-...210.......220....--....230.-......240.......250.......260....---.---..270.......----280-----------....--------------------.-.----------------..-------.290.......300.......310.......320.......330.......340.......350--.......360.......370.-.....--.380.---....-..390......-..400...--....410.......420.......430.......440.......450-----------------------------------------------------------------.---......460.......470.......480.......490.......500.......510...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTKRALISVSDKSGIIDFAKELKNLGWDIISTGGTKVALDDAGVETIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDADSHLQAAKDNNIELIDLVVVNLYPFKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDSADYATVLGEL--AD--A--SQTTFKTRQRLAAKAFRHTAAYDALIAEY----FTAQVGE-----A-KPEKLTITY-DLKQAMRYGENPQQD-ADFY--QKALPTDY-SIASAKQLNGKELSFNNIRDADAAIRIIRDFKD---S---PTVVALKHMNPC----G-------------IGQA--------------------D-D----------------IE-------TAWDYAYEADPVSIFGGIVVLNREVDAATAEKMHPIFLEIIIAPSYSEEALAILTNKKKNLRIL--ELPFDAQAASEVEAEYTGVVG-GLLVQ--NQDVV---AENP-SDW-QVVTDRQ-PTEQEATA--LEFAWKAIKYVKSNGIIITNDHMTLGLGAGQTNRVGSVKIAIEQAKD-----------------------------------------------------------------H---LDGAVLASDAFFPFADNIEEIAAAGIKAIIQPGGSVRDQESIDAANKHGLTMIFTGVRHFRH
2 PsiBlast_PDB 95.0543% -88 - C12 -4A1O PUR9_MYCTU A:[11-523] --RRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFP---DGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL---R--A--GGFTLAERKRLASLAFQHIAEYDIAVASW----MQQTLAPEHPVAA-FPQWFGRSW-RRVAMLRYGENPHQQ-AALY--GD--PTAWPGLAQAEQLHGKDMSYNNFTDADAAWRAAFDHEQ---T----CVAIIKHANPC----G-------------IAIS--------------------SVS----------------VA-------DAHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLA-RKKNIRVL--VAAEPLAGGSELRP----ISG-GLLIQ--QSDQLDAHGDNP-ANW-TLATGSP-ADPATLTD--LVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVDAARLAVERGGE-----------------------------------------------------------------R---VRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
1 PsiBlast_PDB 94.9143% -86 - C12 -3ZZM PUR9_MYCTU A:[11-523] --RRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL---R--A--GGFTLAERKRLASLAFQHIAEYDIAVASW----MQQTLAPEHPVAA-FPQWFGRSW-RRVAMLRYGENPHQQ-AALY--GD--PTAWPGLAQAEQLHGKDMSYNNFTDADAAWRAAFDHEQ---T----CVAIIKHANPC----G-------------IAIS--------------------SVS----------------VA-------DAHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLA-RKKNIRVL--VAAEPLAGGSELRP----ISG-GLLIQ--QSDQLDAHGDNP-ANW-TLATGSP-ADPATLTD--LVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVDAARLAVERGGE-----------------------------------------------------------------R---VRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
22 PsiBlast_CBE 93.7843% -87 - C12 -3ZZM PUR9_MYCTU B:[11-523] --RRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL---R--A--GGFTLAERKRLASLAFQHIAEYDIAVASW----MQQTLAPEHPVAA-FPQWFGRSW-RRVAMLRYGENPHQQ-AALY--GD--PTAWPGLAQAEQLHGKDMSYNNFTDADAAWRAAFDHEQ---T----CVAIIKHANPC----G-------------IAIS--------------------SVS----------------VA-------DAHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLA-RKKNIRVL--VAAEPLAGGSELRP----ISG-GLLIQ--QSDQLDAHGDNP-ANW-TLATGSP-ADPATLTD--LVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVDAARLAVERGGE-----------------------------------------------------------------R---VRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
21 PsiBlast_CBE 93.6043% -87 - C12 -4A1O PUR9_MYCTU B:[11-523] --RRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL---R--A--GGFTLAERKRLASLAFQHIAEYDIAVASW----MQQTLAPEHPVAA-FPQWFGRSW-RRVAMLRYGENPHQQ-AALY--GD--PTAWPGLAQAEQLHGKDMSYNNFTDADAAWRAAFDHEQ---T----CVAIIKHANPC----G-------------IAIS--------------------SVS----------------VA-------DAHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLA-RKKNIRVL--VAAEPLAGGSELRP----ISG-GLLIQ--QSDQLDAHGDNP-ANW-TLATGSP-ADPATLTD--LVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVDAARLAVERGGE-----------------------------------------------------------------R---VRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
49 HHSearch 91.1539% -81 - C12 -1G8M PUR9_CHICK A:[5-593] -QQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARN-IPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEM--AASKD--KDTSVETRRHLALKAFTHTAQYDAAISDY----FRKEYS---------------KG-VSQLPLRYGMNPHQS-PAQL--YTTRP-----KLPLTVVNGS-PGFINLCDALNAWQLVKELKQALGI---PAAASFKHVSPA----G-------------AAVGIPLSEEEAQVCMVHDLHKTLT-P----------------LA-------SAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKIL-SKKKNGGYC--VLQMDPNY-EPDDNEIRTLYG-LQLMQ--KRNNA---VIDR-SLFKNIVTKNKTLPESAVRD--LIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAK---LTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
3 PsiBlast_PDB 90.1041% -92 - C12 -4EHI PUR9_CAMJE A:[26-534] ---RALLSVSDKEGIVEFGKELENLGFEILSTGGTFKLLKENGIKVIEVSDFT--------------------------------------ILGIDLVCVNLYPFKKTTIMSD-DFDEIIENIDIGGPAMIRSAAKNYKDVMVLCDPLDYEKVI-ET--LK--K--GQNDENFRLNLMIKAYEHTANYDAYIANYMNERFNGGFGA-----S-KFIVGQKVF-DTK----YGENPHQK-GALY--E--FDAFF-S-ANFKALKG-EASFNNLTDINAALNLASSFDK---A---PAIAIVKHGNPC----G-------------FAIK--------------------E-N----------------LV-------QSYIHALKCDSVSAYGGVVAINGTLDEALANKINEIYVEVIIAANVDEKALAVFEGKKR-IKIFTQESPFLIRSFDKY--DFKHIDG-GFVYQ--NSDEV---GEDELKNA-KLMSQRE-ASKEELKD--LEIAMKIAAFTKSNNVVYVKNGAMVAIGMGMTSRIDAAKAAIAKAKE-----------------------------------------------------------------MGLDLQGCVLASEAFFPFRDSIDEASKVGVKAIVEPGGSIRDDEVVKAADEYGMALYFTGVRHFLH
26 PsiBlast_CBE 82.4237% -79 - C12 -1PKX PUR9_HUMAN D:[7-462] ----ALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMAR-LDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSE--S--KDTSLETRRQLALKAFTHTAQYDEAISDY----FRKQYSK-----G-VSQ----------MPLRYGMNPHQTPAQLYTLQPKLPITV--------LNGAP-GFINLCDALNAWQLVKELKE---ALGIPAAASFKHVSPAGAAVG-------------IPLS--------------------E-DEAKVCMVYDLYKTLTPIS-------AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILS-KKKNGNYC--VLQMD-QSYKPDENEVRTLFG-LHLSQKRNNGVV---DKSL-FSN-VVTKNKD-LPESALRD--LIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANY-----------------------------------------------------------------W---WLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEW
28 PsiBlast_CBE 82.3637% -79 - C12 -1PKX PUR9_HUMAN B:[7-462] ----ALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMAR-LDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSE--S--KDTSLETRRQLALKAFTHTAQYDEAISDY----FRKQYSK-----G-VSQ----------MPLRYGMNPHQTPAQLYTLQPKLPITV--------LNGAP-GFINLCDALNAWQLVKELKE---ALGIPAAASFKHVSPAGAAVG-------------IPLS--------------------E-DEAKVCMVYDLYKTLTPIS-------AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILS-KKKNGNYC--VLQMD-QSYKPDENEVRTLFG-LHLSQKRNNGVV---DKSL-FSN-VVTKNKD-LPESALRD--LIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANY-----------------------------------------------------------------W---WLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEW
30 PsiBlast_CBE 82.3035% -85 - C12 -1ZCZ PUR9_THEMA B:[14-464] --KRILVSLYEKEKYLDILRELHEKGWEIWASSGTAKFLKSNGIEANDVSTITGFENLLGGLVKTLHPEIFAGILGPEPR--------------WDVVFVDLYP------PPD---------IDIGGVALLRAAAKNWKKVKPAFDMETLKLAI-EI--DD--E-------ETRKYLAGMTFAFTSVYDSIRANQ----FVEGISL-----AFKREDLQ---------LRYGENPHEK-AFVY--GK---PAF-EILH----EGKTISFNNILDAENAWFMAKNLPR---M---GAVV-VKHQSPC----G-------------AAIG--------------------E-D----------------KV-------EIVKKAIEADDESSFGGILAVNFEMDEEVAKSLKK-YLEVIVAPSFTQEAIEVLSKKK--VRLL--K-PGDY-------ASWAGKMAFGSLVL--SERKY---PEG---NF-ELVVGEP-LSEKELED--LEFAYRVVEGAKSNAVLIAKDGVTVGIGSGQPSRKRAAWIATVMAGE-----------------------------------------------------------------K---AKGAVAASDAFFPFPDSLEILAQAGVKAVVAPLGSIRDEEVIEKARELGITFYKAPSRVFRH
29 PsiBlast_CBE 82.2837% -77 - C12 -1P4R PUR9_HUMAN B:[7-462] ----ALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMAR-LDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSE--S--KDTSLETRRQLALKAFTHTAQYDEAISDY----FRKQYSK-----G-VSQ----------MPLRYGMNPHQTPAQLYTLQPKLPITV--------LNGAP-GFINLCDALNAWQLVKELKE---ALGIPAAASFKHVSPAGAAVG-------------IPLS--------------------E-DEAKVCMVYDLYKTLTPIS-------AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILS-KKKNGNYC--VLQMD-QSYKPDENEVRTLFG-LHLSQKRNNGVV---DKSL-FSN-VVTKNKD-LPESALRD--LIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANY-----------------------------------------------------------------W---WLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEW
7 PsiBlast_PDB 82.1535% -83 - C12 -1ZCZ PUR9_THEMA A:[14-464] --KRILVSLYEKEKYLDILRELHEKGWEIWASSGTAKFLKSNGIEANDVSTITGFENLLGGLVKTLHPEIFAGILGPEPR--------------WDVVFVDLYP------PPD---------IDIGGVALLRAAAKNWKKVKPAFDMETLKLAI-EI--DD--E-------ETRKYLAGMTFAFTSVYDSIRANQ----FVEGISL-----AFKREDLQ---------LRYGENPHEK-AFVY--GK---PAF-EILH----EGKTISFNNILDAENAWFMAKNLPR---M---GAVV-VKHQSPC----G-------------AAIG--------------------E-D----------------KV-------EIVKKAIEADDESSFGGILAVNFEMDEEVAKSLKK-YLEVIVAPSFTQEAIEVLSKKK--VRLL--K-PGDY-------ASWAGKMAFGSLVL--SERKY---PEG---NF-ELVVGEP-LSEKELED--LEFAYRVVEGAKSNAVLIAKDGVTVGIGSGQPSRKRAAWIATVMAGE-----------------------------------------------------------------K---AKGAVAASDAFFPFPDSLEILAQAGVKAVVAPLGSIRDEEVIEKARELGITFYKAPSRVFRH
23 PsiBlast_CBE 81.9437% -80 - C12 -1PL0 PUR9_HUMAN D:[7-462] ----ALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMAR-LDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSE--S--KDTSLETRRQLALKAFTHTAQYDEAISDY----FRKQYSK-----G-VSQ----------MPLRYGMNPHQTPAQLYTLQPKLPITV--------LNGAP-GFINLCDALNAWQLVKELKE---ALGIPAAASFKHVSPAGAAVG-------------IPLS--------------------E-DEAKVCMVYDLYKTLTPIS-------AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILS-KKKNGNYC--VLQMD-QSYKPDENEVRTLFG-LHLSQKRNNGVV---DKSL-FSN-VVTKNKD-LPESALRD--LIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANY-----------------------------------------------------------------W---WLRHHPQVLSMISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSIS
24 PsiBlast_CBE 81.9037% -77 - C12 -1PL0 PUR9_HUMAN C:[7-462] ----ALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMAR-LDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSE--S--KDTSLETRRQLALKAFTHTAQYDEAISDY----FRKQYSK-----G-VSQ----------MPLRYGMNPHQTPAQLYTLQPKLPITV--------LNGAP-GFINLCDALNAWQLVKELKE---ALGIPAAASFKHVSPAGAAVG-------------IPLS--------------------E-DEAKVCMVYDLYKTLTPIS-------AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILS-KKKNGNYC--VLQMD-QSYKPDENEVRTLFG-LHLSQKRNNGVV---DKSL-FSN-VVTKNKD-LPESALRD--LIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANY-----------------------------------------------------------------W---WLRHHPQVLSMKFKTGAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEK
5 PsiBlast_PDB 81.8637% -75 - C12 -1P4R PUR9_HUMAN A:[7-462] ----ALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMAR-LDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSE--S--KDTSLETRRQLALKAFTHTAQYDEAISDY----FRKQYSK-----G-VSQ----------MPLRYGMNPHQTPAQLYTLQPKLPITV--------LNGAP-GFINLCDALNAWQLVKELKE---ALGIPAAASFKHVSPAGAAVG-------------IPLS--------------------E-DEAKVCMVYDLYKTLTPIS-------AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILS-KKKNGNYC--VLQMD-QSYKPDENEVRTLFG-LHLSQKRNNGVV---DKSL-FSN-VVTKNKD-LPESALRD--LIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANY-----------------------------------------------------------------W---WLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEW