@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs0039: (2015-11-27 )
MTRTVAIDIGGTMIKHGIVDNLGCIVEASELATEAYKGGPGILQKVCQIIDNYLTEGSIDGIAISSAGMVDPDEGCIFYSGPQIPNYAGTQFKKVLEDTYQVRTEIENDVNCAGLAEAVSGSAKDSSIALCLTIGTGIGGCLIIDKTVFHGFSNSACEVGYMHLSDGDFQDLASTTALIADVAKAHGDEISRWDGRRIFQEAKEGNEKCIASIDRMINYLGQGIANMVYVVNPEKVVLGGGIMAQKDYLQDKLSESLKRNLVTSLAEKTAIVFAQHENQAGMLGAYYHFKNRG

Atome Classification :

(20 SA) -------------------------------------------------------------------------.........10........20.--......-.30........----40......--..50..-..-----.-----...60--........70......--..80.......-.-90-........100.......110.......120-------------.......130.......140.......150.......160.------.----------.-------.--------------------..----------.170-------.........-------------180----------------......--..-------.------------190------------.-------------.....------...200----------.---...-...210.......220.......230.--......240...-....250.......260.--.-.....270.-......280.......290.-----------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------------------------------------------------------MTRTVAIDIGGTMIKHGIVDNL--GCIVEA-SELATEAYKGG----PGILQKVC--QIIDNY-LT-----E-----GSIDG--IAISSAGMVDPDEGCI--FYSGPQIPNYA-G-TQ-FKKVLEDTYQVRTEIENDVNCAGLAEAVSGS-------------AKDSSIALCLTIGTGIGGCLIIDKTVFHGFSNSACEVGYMH------L----------S-------D--------------------GD----------FQ---------DLASTTALI-------------A------------------DVAKAH--GD-------E------------I--------------S-------------RWDGR------RIFQEA----------K---EGN-EKCIASIDRMINYLGQGIANMVYVVNP--EKVVLGGGIMAQ-KDYLQDKLSESLKRNLVT--S-LAEKTAIVF-AQHENQAGMLGAYYHFKNRG-----------
31 HHSearch 89.7731%-103 - C1 -2GUP ? A:[4-288] --------------------------------------------------------------------------MTIATIDIGGTGIKFASLTPD--GKILDK-TSISTPE--NL----E----DLL--AWLDQR-LS-----E-----QDYSG--IAMSVPGAVNQETGVI--DGF-SAVPYIH-G-FS-WYEALS-SYQLPVHLENDANCVGLSELLAHP---------------ELENAACVVIGTGIGGAMIINGRLHRGRHGLGGEFGYMT------T----------L-------APAEKL---------------NN----------WS---------QLASTGNMV-------------R------------------YVIEKS--GH-----------------------------------T-------------DWDGR------KIYQEA----------A---AGN-ILCQEAIERMNRNLAQGLLNIQYLIDP--GVISLGGSISQN--PDFIQGVKKAVEDFVDAYEE-YTVAPVIQA-CTYHADANLYGALVNWLQEE-----------
25 HHSearch 88.6628%-107 - C1 -3VOV ? A:[1-296] --------------------------------------------------------------------------MKVVGLDLGGTKIAAGVFDG---KRLLSK-VVVPTPKE-GG----ERVAEALA--EAAERA-EREA---G-----VRGEA--IGLGTPGPLDFRRGVI--R----NIPGVQ-D-FP-IRRILEEATGRPVFLENDANAAALAEHHLGA-------------AQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELGHLT------L----------L-------PGGPACGCGLE----------GC----------LE---------ALAAGRALE-------------R------------------DATYAF--Q------------------------------------R-------------PVDTR------ELFRLF----------Q---AGD-PKAERLVLQAARYVGIGLASLVKAFDP--GVVVLGGGVALNAPEGYWEALLEAYRRYLQG-----WEAPPLRR-ARLGAEAGLLGAALTAYLEV-----------
23 HHSearch 87.8926% -96 - C1 -3VGL ? A:[2-313] --------------------------------------------------------------------------GLTIGVDIGGTKIAAGVVDEE--GRILST-FKVATPP--TA----EGIVDAIC--AAVAGA-SE-----G-----HDVEA--VGIGAAGYVDDKRATV--LFA-PNI-DWR-H-EP-LKDKVEQRVGLPVVVENDANAAAWGEYRFGA-------------GQGHDDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIR------V----------V-------PDGLLCGCGSQ----------GC----------WE---------QYASGRALV-------------R------------------YAKQRA--NA-------T------------PENAAVLLGLGDGSVD-------------GIEGK------HISEAA----------R---QGD-PVAVDSFRELARWAGAGLADLASLFDP--SAFIVGGGVSDE-GELVLDPIRKSFRRWLIG--GEWRPHAQVLA-AQLGGKAGLVGAADLARQG------------
8 PsiBlast_PDB 86.9626%-102 - C1 -3VGM ? A:[2-306] --------------------------------------------------------------------------GLTIGVDIGGTKIAAGVVDEE--GRILST-FKVATPPTA------EGIVDAIC--AAVAGA-SE-----G-----HDVEA--VGIGAAGYVDDKRATV--LFA-PNI-DWR-H-EP-LKDKVEQRVGLPVVVENDANAAAWGEYRFGA-------------GQGHDDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIR------VVPDGLLCGCGS-------Q--------------------GC----------WE---------QYASGRALVRYAKQRANATPENA------------------AVLLGL--GDG------S------------V--------------D-------------GIEGK------HISEAA----------R---QGD-PVAVDSFRELARWAGAGLADLASLFDP--SAFIVGGGVSDE-GELVLDPIRKSFRRWLIG--G-EWRPHAQVLAAQLGGKAGLVGAADLARQG------------
6 PsiBlast_PDB 85.9226%-105 - C1 -3VGK ? A:[3-306] ---------------------------------------------------------------------------LTIGVDIGGTKIAAGVVDEE--GRILST-FKVATPPTA------EGIVDAIC--AAVAGA-SE-----G-----HDVEA--VGIGAAGYVDDKRATV--LFA-PNI-DWR-H-EP-LKDKVEQRVGLPVVVENDANAAAWGEYRFGA-------------GQGHDDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIR------VVPDGLLCGCGS-------Q--------------------GC----------WE---------QYASGRALVRYAKQRANATPENA------------------AVLLGL--GDG------S------------V--------------D-------------GIEGK------HISEAA----------R---QGD-PVAVDSFRELARWAGAGLADLASLFDP--SAFIVGGGVSDE-GELVLDPIRKSFRRWLIG--G-EWRPHAQVLAAQLGGKAGLVGAADLARQG------------
7 PsiBlast_PDB 85.6526% -95 - C1 -3VGL ? A:[2-306] --------------------------------------------------------------------------GLTIGVDIGGTKIAAGVVDEE--GRILST-FKVATPPTA------EGIVDAIC--AAVAGA-SE-----G-----HDVEA--VGIGAAGYVDDKRATV--LFA-PNI-DWR-H-EP-LKDKVEQRVGLPVVVENDANAAAWGEYRFGA-------------GQGHDDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIR------VVPDGLLCGCGS-------Q--------------------GC----------WE---------QYASGRALVRYAKQRANATPENA------------------AVLLGL--GDG------S------------V--------------D-------------GIEGK------HISEAA----------R---QGD-PVAVDSFRELARWAGAGLADLASLFDP--SAFIVGGGVSDE-GELVLDPIRKSFRRWLIG--G-EWRPHAQVLAAQLGGKAGLVGAADLARQG------------
2 PsiBlast_PDB 84.9630%-101 - C1 -4HTL BGLK_LISMO A:[5-289] ---------------------------------------------------------------------------KIAAFDIGGTALKMGVVLPH--GEIILT-KSAEISGSDGD----QILAEMKV--FLAENT---------------DVTG--IAVSAPGYVNPKTGLI--TMGG-AIRRFD-N-FN-LKEWLEAETGLPVAIENDANCALLAEKWLGK-------------GQDLDDFLCLTIGTGIGGGIFSNGELVRGGRFRAGEFGYMFSERPGAF----------R-------P--------------------GK----------YT---------LNETTTMLVLR-----------R------------------QYAELT--GR-------P------------L--------------E-------------EITGE------EIFANY----------D---AHD-AVSERLITEFYTGICTGLYNLIYLFDP--THIFIGGGITSR-PTFIAE-----LKHHMES--F-GLRDTIIET-ATHKNQAGLLGAVYHFLQEE-----------
3 PsiBlast_PDB 83.9524%-111 - C1 -2QM1 ? A:[7-315] ---------------------------------------------------------------------------KIIGIDLGGTTIKFAILTTD--GVVQQK-WSIETNILEDGKHIVPSIIESIR--HRIDLYNMK-----K-----EDFVG--IGMGTPGSVDIEKGTV--V--GAYNLNWT-T-VQPVKEQIESALGIPFALDNDANVAALGERWKGA-------------GENNPDVIFITLGTGVGGGIVAAGKLLHGVAGCAGEVGHVT------V----------D-------P--------------------NG----------FDCTCGKRGCLETVSSATGV-------------V------------------RVARHL--SE-------E------------F--------------AGDSELKQAIDDGQDVSSK------DVFEFA----------E---KGD-HFALMVVDRVCFYLGLATGNLGNTLNP--DSVVIGGGVSAA-GEFLRSRVEKYFQEFTFP--Q-VRNSTKIKL-AELGNEAGVIGAASLALQFS-----------
30 HHSearch 83.2924%-103 - C1 -2AP1 NAGK_SALTY A:[24-326] --------------------------------------------------------------------------AMYYGFDIGGTKIALGVFDST--RRLQWE-KRVPTPHT-SY----SAFLDAVC--ELVEEA-DQR----F-----GVKGS--VGIGIPGMPETEDGTL--YAA-N-VPAAS-G-KP-LRADLSARLDRDVRLDNDANCFALSEAWDDE-------------FTQYPLVMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMR------L----------P-------VDALTLMGFDFPLRRCGCGQMGC----------IE---------NYLSGRGFA-------------W------------------LYQHYY--D------------------------------------Q-------------SLQAP------EIIALW----------E---QGD-EQAHAHVERYLDLLAVCLGNILTIVDP--DLLVIGGGLSNF--TAITTQLAERLPRHLLP----VARAPRIER-ARHGDAGGMRGAAFLHLTD------------
22 HHSearch 82.9724%-109 - C1 -2QM1 ? A:[5-322] -------------------------------------------------------------------------DKKIIGIDLGGTTIKFAILTTD--GVVQQK-WSIETNILEDG----KHIVPSII--ESIRHR-IDLYNMKK-----EDFVG--IGMGTPGSVDIEKGTV--VGA-YNL-NWT-TVQP-VKEQIESALGIPFALDNDANVAALGERWKGA-------------GENNPDVIFITLGTGVGGGIVAAGKLLHGVAGCAGEVGHVT------V----------D-------PNGFDCTCGKR----------GC----------LE---------TVSSATGVV-------------R------------------VARHLS--EE-------FAGDSELKQAIDDG--------------Q-------------DVSSK------DVFEFA----------E---KGD-HFALMVVDRVCFYLGLATGNLGNTLNP--DSVVIGGGVSAA-GEFLRSRVEKYFQEFTFP--Q-VRNSTKIKL-AELGNEAGVIGAASLALQFS-----------
14 PsiBlast_PDB 82.4726% -94 - C1 -3VOV ? A:[2-289] ---------------------------------------------------------------------------KVVGLDLGGTKIAAGVFD----GKRLLS-KVVVPTPKEGG----ERVAEALA--EAAERA-ER-----E-----AGVRGEAIGLGTPGPLDFRRGVI--R----NIPGVQ-D-FP-IRRILEEATGRPVFLENDANAAALAEHHLGA-------------AQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELGHLT------L----------L-------P--------------------GGPACGCGLEGCLE---------ALAAGRALE-------------R------------------DATYAF--QR-------P------------V------------------------------DTR------ELFRLF----------Q---AGD-PKAERLVLQAARYVGIGLASLVKAFDPGVVVLGGGVALNAP-EGYW-EALLEAYRRYLQG--W---EAPPLRR-ARLGAEAGLLGAALTAYLEV-----------
26 HHSearch 82.0920%-109 - C1 -1Z05 ? A:[108-416] --------------------------------------------------------------------------WQFLSMRLGRGYLTIALHELG--GEVLID-TKIDIHEI-DQ----DDVLARLL--FEIEEF-FQTYAAQL-----DRVTS--IAITLPGLVNSEQGIV--LQM-PHY-NVK-N-LA-LGPEIYKATGLPVFVANDTRAWALAEKLFGH-------------SQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQ------I----------D-------PQGKRCHCGNY----------GC----------LE---------TVASSQAIR-------------D------------------QVTARI--QA-------G------------EPSCLATV-------E-------------EISIE------DICAAA----------A---DGD-PLAVDVIQQLGRYLGAAIAIVINLFNP--EKILIGGVINQA-KSILYPSIEQCIREQSLP--V-YHQDLKLVE-SRFYKQATMPGAALIKQALY-----------
15 PsiBlast_PDB 79.8922% -99 - C1 -2AP1 NAGK_SALTY A:[29-322] -------------------------------------------------------------------------------FDIGGTKIALGVFDST--RRLQWE-KRVPT-PHTSY----SAFLDAVC--ELVEEA-DQ-----R-----FGVKGS-VGIGIPGMPETEDGTL--YAA--NVPAAS-G-KP-LRADLSARLDRDVRLDNDANCFALSEAWDDE-------------FTQYPLVMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMR------L----------PVDALTLMG--------------------FD----------FP---------LRRCGCGQM-------------G------------------CIENYL--SG-------R------------G--------------F-------------AWLYQ------HYYDQSLQAPEIIALWE---QGD-EQAHAHVERYLDLLAVCLGNILTIVDP--DLLVIGGG-LSN-FTAITTQLAERLPRHLL---P-VARAPRIER-ARHGDAGGMRGAAFLHLTD------------
1 PsiBlast_PDB 79.7033%-117 - C1 -2GUP ? A:[9-245] -------------------------------------------------------------------------------IDIGGTGIKFASLTPD--GKILDK-TSIST----------PENLEDLL--AWLDQR-LS-----E-----QDYSG--IAMSVPGAVNQETGVIDGFSAVPYI---H-G-FS-WYEAL-SSYQLPVHLENDANCVGLSELLAHP-------------ELEN--AACVVIGTGIGGAMIINGRLHRGRHGLGGEFGYMT------TLAPAE-----K-------L--------------------NN----------WS---------QLASTGNMV-------------R------------------YVIEKS--GH-----------------------------------T-------------DWDGR------KIYQEA----------A---AGN-ILCQEAIERMNRNLAQGLLNIQYLIDP--GVISLGGSISQN-PDFIQGVKKAVEDFVDAY--E-EYTVAPVIQ-ACTYHADANLYGALVNWLQE-----------
48 Fugue 79.6218%-105 - C1 -1Z05 ? A:[34-429] DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELG--GEVLID-TKIDIHE-IDQ----DDVLARLL--FEIEEF-FQ-----TYAAQLDRVTS--IAITLPGLVNSEQGIV--LQM--PHYNVK-N-LA-LGPEIYKATGLPVFVANDTRAWALAEKLFGH-------------SQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQ------IDPQGKRCHCGN-------Y--------------------GC----------LE---------TVASSQAIR-------------D------------------QVTARI--QAGEPSCLAT------------V--------------E-------------EISIE------DICAAA----------A---DGD-PLAVDVIQQLGRYLGAAIAIVINLFNP--EKILIGGVINQA-KSILYPSIEQCIREQSLP--V-YHQDLKLVE-SRFYKQATMPGAALIKQALYDGLLLMKVVEG
24 HHSearch 75.4323%-100 - C1 -2AA4 NANK_ECOLI A:[1-289] --------------------------------------------------------------------------MTTLAIDIGGTKLAAALIGAD--GQIRDR-RELPTPASQTP----EALRDALS--ALVSPL-Q------------AHAQR--VAIASTGIIRDGSLLA--LNP-HNLGGLL-H-FP-LVKTLEQLTNLPTIAINDAQAAAWAEFQALD--------------GDITDMVFITVSTGVGGGVVSGCKLLTGPGGLAGHIGHTL------A----------D-------PHGPVCGCGRT----------GC----------VE---------AIASGRGIA-------------A------------------AAQGEL--A--------------------------------------------------GADAK------TIFTRA----------G---QGD-EQAQQLIHRSARTLARLIADIKATTDC--QCVVVGGSVGLA--EGYLALVETYLAQEPA------AFHVDLLA-AHYRHDAGLLGAALLAQGE------------
29 HHSearch 74.3220%-100 - C1 -1Z6R MLC_ECOLI A:[85-389] --------------------------------------------------------------------------WHYLSLRISRGEIFLALRDLS--SKLVVE-ESQELALK-DD----LPLLDRII--SHIDQF-FIRHQKKL-----ERLTS--IAITLPGIIDTENGIV--HRM-PFYEDVK-E-MP-LGEALEQHTGVPVYIQHDISAWTMAEALFGA-------------SRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQ------V----------D-------PYGKRCYCGNH----------GC----------LE---------TIASVDSIL-------------E------------------LAQLRL--NQ-------S------------MSSMLHG--------Q-------------PLTVD------SLCQAA----------L---RGD-LLAKDIITGVGAHVGRILAIMVNLFNP--QKILIGSPLSKA-ADILFPVISDSIRQQALP--A-YSQHISVES-TQFSNQGTMAGAALVKDAMY-----------
5 PsiBlast_PDB 72.6225% -95 - C1 -4DB3 NAGK_VIBVU A:[29-322] -------------------------------------------------------------------------------FDVGGTKIEFGAFNEKLERVATER-VPTPTDDY-------PLLLETIA--GLVAKY-DQ-----E-----FACEGK-IGLGLPGMEDADDATV--LTV--NVPAAK-G-KP-LRADLEAKIGRSVKIENDANCFALSEAWDEE-------------LQDAPSVMGLILGTGFGGGLIYEGKVFSGRNNVAGELGHMR------L----------P-------L--------------------DA----------WF---------HLGDNAPLL-------------GCGCGKKGCLDSYLSGRGFELLYAHYYGE-------E------------K--------------K-------------AID---------IIKAN----------A---AGD-EKAAEHVERFMELLAICFGNIFTANDP--HVVALGGG-LSN-FELIYEEMPKRVPKYLL---S-VAKCPKIIK-AKHGDSGGVRGAAFLNIKG------------
11 PsiBlast_PDB 68.5428%-103 - C1 -2YI1 A:[33-292] -----------------------------------------------------------------------------LAVDLGGTNLRVAIVSMK--GEIVKKYTQFNPKTYEER----INLILQMCVEAAAEAV-KL-----N-----CRILG--VGISTGGRVNPREGIV--LHSTKLIQEWN-S-VD-LRTPLSDTLHLPVWVDNDGNCAALAERKFGQ-------------GKGLENFVTLITGTGIGGGIIHQHELIHGSSFCAAELGHLV------VSLDGPDCSCGS-------H--------------------GC----------IE---------AYASGMALQ-------------R------------------EAKKLH--DE-------D------------L--------------L-------------LVEGMSAVGALHLIQAA----------K---LGN-AKAQSILRTAGTALGLGVVNILHTMNP--SLVILSGVLASH-YIHIVKDVIRQQALSSVQ--D-VDVVVSDLV-DPALLGAASMVLDYT----------------
33 HHSearch 68.2720%-105 - C1 -3MCP ? A:[8-320] -------------------------------------------------------------------------NRIVMTLDAGGTNFVFSAIQGG--KEIADP-VVLPACAD-CL----DKCLGNLV--EGFKAI-QAGL---P-----EAPVA--ISFAFPGPADYQAGII--GDL-PNFPSFRGG-VA-LGPFLEDIFGIPVFINNDGSLFAYGEALTGVLPEINRRLREAGSTKRYKNLLGVTLGTGFGAGVVIDGELLRGDNAAGGYVWCLR------N----------K-------KYPE-----------------YI----------VE---------ESVSIRAVM-------------R------------------VYAERS--GD--------------------A--------------G-------------ARTPK------EIFEIA----------EGIRPGNREAAIAAFEELGEMAGDALASAITLID---GLIVIGGGLSGA-SKYILPVLLKEMNAQTGM--M------QKEV-YDLDEEKSFAGFARGEAVEV-----------