@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs0042: (2015-11-27 )
MKLLVVGSGGREHAIAKKLLASKDVDQVFVAPGNDGMTLDGLDLVNIGISEHSRLIDFAKENEIAWTFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSKDFAKEIMVKYNVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQAVEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFANGDKFYIMPTAQDHKRAFDGDKGPNTGGMGAYAPVPHLPQSVVDTAVETIIKPVLEGMIAEGRPYLGVLYAGLILTADGPKVIEFNSRFGDPETQIILPRLTSDFAQNIDDIMMGIEPYITWQKDGVTLGVVVASEGYPLDYEKGVPLPEKTDGDIITYYAGAKFAENSKALLSNGGRVYMLVTTEGSVKAGQDKIYTQLAQQDTTGLFYRNDIGSKAIK

Atome Classification :

(20 SA) .........10.-..-..-.-...20...-.....30......-.-.-40..-.......50........60........70........80........90........100.......110.......120.......130.......140........150.......160.......170.......180.......190.......200.......210.......220.......230.-......240....-....-----250........260.......270.....-..-280.......290.......300.......310.---..--.--...320-----.-.......330...---....340..-----.--..---.---.--350--..---.----......-----360.......370.......380.......390.......400.-......410.......420
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKLLVVGSGG-R-EH-AI-A-KKLLASKD-VDQVFVAPGNDGM-T-L-D-GL-DLVNIGISEHSRLIDFAKENEIAWTFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSKDFAKEIMVKYNVPTAAYGTFSDFEKAKAYIEEQGAP-IVVKADGLALGKGVVVAETVEQAVEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFANGDKFYIMPTAQDHKRAFDGDKGPNTGGMGAYA-PVPHLPQ-SVVDT-AVET-----I-IKPVLEGMIAEGRPYLGVLYAGLILTA-DG-PKVIEFNSRFGDPETQIILPRLTSDFAQNIDDIM---MG--I--EPYI-T-----W-QKDGVTLGVVVAS---EGYPLDYEK-----G--VP---L---P--E----KT---D----GDIITY-----YAGAKFAENSKALLSNGGRVYMLVTTEGSVKAGQDKIYTQLAQQ-DTTGLFYRNDIGSKAIK
2 PsiBlast_PDB 93.7452%-103 - C1 -2YRW ? A:[22-439] MNVLVIGRGG-R-EH-AI-A-WKAAQSPL-VGKLYVAPGNPGI-A---D-VA-ELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD------GVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDA-ALEA-----I-LRPAAKALAAEGRPFLGVLYAGLMATA-NG-PKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVM---DG--K--ELEL-E-----W-TDEAV-LGVVLAA---KGYPGAYER-----G--AE---I---RGLD----RI---S----PDALLF-----HAGTK--REGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAI-DCDGLFYRRDIGRRAIE
4 PsiBlast_PDB 93.3952%-100 - C1 -2YS6 ? A:[22-439] MNVLVIGRGG-R-EH-AI-A-WKAAQSPL-VGKLYVAPGNPGI-A---D-VA-ELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD----GKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDA-ALEA-----I-LRPAAKALAAEGRPFLGVLYAGLMATA-NG-PKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVM---DG--K--ELEL-E-----W-TDEAV-LGVVLAA---KGYPGAYER-----G--AE---I---RGLD----RI---S----PDALLF-----HAGTK--REGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAI-DCDGLFYRRDIGRRAIE
3 PsiBlast_PDB 92.8452%-101 - C1 -2YRX ? A:[22-438] MNVLVIGRGG-R-EH-AI-A-WKAAQSPL-VGKLYVAPGNPGI-A---D-VA-ELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD----GKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDA-ALEA-----I-LRPAAKALAAEGRPFLGVLYAGLMATA-NG-PKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVM---DG--K--ELEL-E-----W-TDEAV-LGVVLAA---KGYPGAYER-----G--AE---I---RGLD----RI---S----PDALLF-----HAGTK--REGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAI-DCDGLFYRRDIGRRAI-
6 PsiBlast_PDB 90.6551% -88 - C1 -2XCL PUR2_BACSU A:[3-418] --VLIIGKGG-R-EH-TL-A-WKAAQSSL-VENVFAAPGNDGM-A-A-S-A--QLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAP-IVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYS-PVPQISE-ETVRH-AVET-----I-VKPAAKAMVQEGRSFTGVLYAGLMLTE-NG-SKVIEFNARFGDPETQVVLPRMESDLVQVLLDLL---DD--K--EVDL-R-----W--KDTAAVSVVLAS---EGYPESYAK-----G--TPIGSL---A--A----ET---E-----QVVVF-----HAGTK-AEGGE-FVTNGGRVANVTAFDETFEAARDRVYKAVDEI-FKPGLFFRKDIGARALK
1 PsiBlast_PDB 90.1652% -85 - C1 -2XD4 PUR2_BACSU A:[1-418] MNVLIIGKGG-R-EH-TL-A-WKAAQSSL-VENVFAAPGNDGM-A-A-S-A--QLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAP-IVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYS-PVPQISE-ETVRH-AVET-----I-VKPAAKAMVQEGRSFTGVLYAGLMLTE-NG-SKVIEFNARFGDPETQVVLPRMESDLVQVLLDLL---DD--K--EVDL-R-----W--KDTAAVSVVLAS---EGYPESYAK-----G--TPIGSL---A--A----ET---E-----QVVVF-----HAGTK-AEGGE-FVTNGGRVANVTAFDETFEAARDRVYKAVDEI-FKPGLFFRKDIGARALK
21 PsiBlast_CBE 88.6446% -88 - C1 -2YW2 PUR2_AQUAE B:[1-420] MKVLVVGNGG-R-EH-AI-A-WKVAQSPL-VKELYVAKGNAGI---W-E-IA-KRVDISPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKR-IREE-----I-VERVIKGLKEEGIYYRGFLYAGLMITK-EG-PKVLEFNVRLGDPEAQPILMRVKNDFLETLLNFY---EG--K--DVHI-K-------EDERYALDVVLAS---RGYPEKPET-----G--KI---I---H--GLDYLKS---M----EDVVVF-----HAGTKKEGN--FTVTSGGRVLNVCAYGKTLKEAKERAYEAIRYV-CFEGMHYRKDIGDKAFK
9 PsiBlast_PDB 88.4846% -89 - C1 -2YYA - PUR2_AQUAE A:[1-420] MKVLVVGNGG-R-EH-AI-A-WKVAQSPL-VKELYVAKGNAGI---W-E-IA-KRVDISPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKR-IREE-----I-VERVIKGLKEEGIYYRGFLYAGLMITK-EG-PKVLEFNVRLGDPEAQPILMRVKNDFLETLLNFY---EG--K--DVHI-K-------EDERYALDVVLAS---RGYPEKPET-----G--KI---I---H--GLDYLKS---M----EDVVVF-----HAGTKKEGN--FTVTSGGRVLNVCAYGKTLKEAKERAYEAIRYV-CFEGMHYRKDIGDKAFK
10 PsiBlast_PDB 88.4544% -98 - C1 -2QK4 PUR2_HUMAN A:[26-448] -RVLIIGSGG-R-EH-TL-A-WKLAQSHH-VKQVLVAPGNAGT-A-CSE-KI-SNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGL---KGVIVAKSKEEACKAVQEIMQE-------ETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYC-PAPQVSN-DLLLK-IKDT-----V-LQRTVDGMQQEGTPYTGILYAGIMLTK-NG-PKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTL---DG--LLCTSLP-V-----W-LENHTALTVVMAS---KGYPGDYTK-----G--VE---ITGFP--E----AQ---A----LGLEVF-----HAGTAL-KNGK-VVTHGGRVLAVTAIRENLISALEEAKKGLAAI-KFEGAIYRKDIGFRAIA
8 PsiBlast_PDB 87.5346% -88 - C1 -2YW2 PUR2_AQUAE A:[1-420] MKVLVVGNGG-R-EH-AI-A-WKVAQSPL-VKELYVAKGNAGI---W-E-IA-KRVDISPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKR-IREE-----I-VERVIKGLKEEGIYYRGFLYAGLMITK-EG-PKVLEFNVRLGDPEAQPILMRVKNDFLETLLNFY---EG--K--DVHI-K-------EDERYALDVVLAS---RGYPEKPET-----G--KI---I---H--GLDYLKS---M----EDVVVF-----HAGTKKEGN--FTVTSGGRVLNVCAYGKTLKEAKERAYEAIRYV-CFEGMHYRKDIGDKAFK
25 HHSearch 86.5249% -86 - C1 -2XCL PUR2_BACSU A:[1-418] MNVLIIGKGG-R-EH-TLAW-KAAQS--S-LVENVFAAPG-ND-G-M-AASA-QLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAP-IVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYS-PVPQISEETVRHA-VE-T-----I-VKPAAKAMVQEGRSFTGVLYAGLMLTE-NG-SKVIEFNARFGDPETQVVLPRMESDLVQVLLDLL---DD--K--EVDL-R-----W-KDT-AAVSVVLAS---EGYPESYAK-----G--TP---I---G--S----LA---AET--EQVVVF-----HAGTKAE-G-GEFVTNGGRVANVTAFDETFEAARDRVYKAVDEI-FKPGLFFRKDIGARALK
26 HHSearch 85.8749% -92 - C1 -2YRX ? A:[22-438] MNVLVIGRGGRE-HA-IA-W-KAAQS--P-LVGKLYVAPGNPG-I-A-D-VA-ELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD----GKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDAALE-A-----I-LRPAAKALAAEGRPFLGVLYAGLMATA-NG-PKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVM---DG--K--ELEL-E-----W-TDE-AVLGVVLAA---KGYPGAYER-----G--AE---I---R--G----LD---RIS--PDALLF-----HAGTKREG--GAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAI-DCDGLFYRRDIGRRAI-
11 PsiBlast_PDB 84.1545% -91 - C1 -3MJF PUR2_YERPE A:[5-427] -NILIIGNGG-R-EH-AL-G-WKAAQSPL-ADKIYVAPGNAGT-A-L-EPTL-ENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAP-IVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYS-PAPVVTD-DVHQR-VMDQ-----V-IWPTVRGMAAEGNIYTGFLYAGLMISA-DGQPKVIEFNCRFGDPETQPIMLRMRSDL---VELCL---AG--T--QGKL-NEKTSDW-DER-PSLGVVLAA---GGYPADYRQGDVIHG--LP---Q---Q--E----VK---D----GKV--F-----HAGTKLNGNHE-VVTNGGRV-LCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIA
29 HHSearch 83.2342% -89 - C1 -2QK4 PUR2_HUMAN A:[25-448] ARVLIIGSGG-R-EH-TL-AWKLAQS--H-HVKQVLVAPGNAG-TAC-SEKI-SNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGL---KGVIVAKSKEEACKAVQEIMQE-------ETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYC-PAPQVSN-DLLLK-IK-D-----TVLQRTVDGMQQEGTPYTGILYAGIMLTK-NG-PKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTL---DG--L--LCTSLPV----W-LENHTALTVVMAS---KGYPGDYTK-----G--VE---I---T--G----FP---EAQA-LGLEVF-----HAGTALKN--GKVVTHGGRVLAVTAIRENLISALEEAKKGLAAI-KFEGAIYRKDIGFRAIA
12 PsiBlast_PDB 83.1239% -94 - C1 -3LP8 ? A:[22-440] MNVLVIGSGG-R-EH-SM-L-HHIRKSTL-LNKLFIAPGREGM-S-----GLADIIDIDINSTIEVIQVCKKEKIELVVIGPETPLMNGLSDALTEEGILVFGPSKAAARLESSKGFTKELCMRYGIPTAKYGYFVDTNSAYKFIDKHKLP-LVVKADGLAQGKGTVICHTHEEAYNAVDAMLVHHKFGEAGCAIIIEEFLEGKEISFFTLVDGSNPVILGVAQDYKTIGDNNKGPNTGGMGSYS-KPNIITQ-EMEHI-IIQK-----I-IYPTIKAMFNMNIQFRGLLFAGIIIKK-NE-PKLLEYNVRFGDPETQSILPRLNSDFLKLLSLTAKGKLG--N--ESVE-L-----S-KK--AALCVVVAS---RGYPGEYKKNSIING--IE---N---I--E----KL---P-----NVQLL-----HAGTRREGNN--WVSDSGRVINVVAQGENLASAKHQAYAALDLL-DWPDGIYRYDIGSC---
27 HHSearch 82.2044% -83 - C1 -2YW2 PUR2_AQUAE A:[1-420] MKVLVVGNGG-REHA-IA-W-KVAQS--P-LVKELYVAKGNAG-I-W-EIAK-R-VDISPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKR-IREE-----I-VERVIKGLKEEGIYYRGFLYAGLMITK-EG-PKVLEFNVRLGDPEAQPILMRVKNDFLETLLNFY---EG--K--DVHI-K-----E-DER-YALDVVLAS---RGYPEKPET-----G--KI---I---H--G----LD---YLKSMEDVVVFHAGTKKEGNFT-------VTSGGRVLNVCAYGKTLKEAKERAYEAIRYV-CFEGMHYRKDIGDKAFK
13 PsiBlast_PDB 80.6541% -89 - C1 -2IP4 ? A:[2-412] -KVLVVGSGG-R-EH-AL-L-WKAAQSPR-VKRLYAAPGNAGM-----E-AL-AELVPWNGDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVP-VVVKDSGLAAGKGVTVAFDLHQAKQAVANIL--NR--AEGGEVVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVA-PYPM-DE-ATLRR-VEEE-----I-LGPLVRGLRAEGVVYRGVVYAGLMLTR-EG-PKVLEFNARFGDPEAQALLPLLENDLVELALRVA---EGRLA--GTRL-S-----W--KEGAAACVVLAA---PGYPESPRK-----G--IP---LHV-P--E----PP---E----G-VLVF-----HAGTR--REGGRLVSAGGRVLNVVGLGRDLKEALERAYAYIPQV-GFPGAVYRRDIGRRALA
30 HHSearch 79.3543% -86 - C1 -3MJF PUR2_YERPE A:[4-427] MNILIIGNGG-R-EHALG-W-KAAQS--P-LADKIYVAPGNAGTA-L-EPTL-ENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAP-IVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYS-PAPVVTD-DVHQR-VM-DQVIWPT-VRGMAAEGN---I-YTGFLYAGLMISADGQ-PKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGT---QG--K--LNEK-TSD---W-DER-PSLGVVLAA---GGYPADYRQ-----G--DV---I---H--G----LP---QQEV-KDGKVF-----HAGTKLNGN-HEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGI-QWEGVFCRKDIGYRAIA
31 HHSearch 77.7237% -83 - C1 -3LP8 ? A:[22-440] MNVLVIGSGG-R-EH-SM-L-HHIRK--STLLNKLFIAPGREG-M-S-GLAD--IIDIDINSTIEVIQVCKKEKIELVVIGPETPLMNGLSDALTEEGILVFGPSKAAARLESSKGFTKELCMRYGIPTAKYGYFVDTNSAYKFIDKHKLP-LVVKADGLAQGKGTVICHTHEEAYNAVDAMLVHHKFGEAGCAIIIEEFLEGKEISFFTLVDGSNPVILGVAQDYKTIGDNNKGPNTGGMGSYSKPNII-TQ-EMEHI-IIQK-----I-IYPTIKAMFNMNIQFRGLLFAGIIIKK-NE-PKLLEYNVRFGDPETQSILPRLNSDFLKLLSLTA---KG--K--LGNE-S-----VELSKKAALCVVVASRGYPGEYKK--------N--SI---I---N--G----IENIEKL---PNVQLL-----HAGTRREG--NNWVSDSGRVINVVAQGENLASAKHQAYAALDLL-DWPDGIYRYDIGSC---