@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs0335: (2015-11-30 )
MQLKDKNIFITGSSRGIGLAIAHQFAQLGANIVLNGRSEISEDLIAEFADYGVKVIAISGDVSSFEDANRMIKEAIASLGSVDVLVNNAGITNDKLMLKMTVEDFESVLKINLTGAFNMTQSVLKPMTKARQGAIINISSVVGLTGNVGQANYAASKAGLIGFTKSVAREVAARGIRVNAIAPGFIESDMTDVIPEKMQEAILAQIPMKRIGKGKEVAQVASFLAEQEYLTGQVIAIDGGMTMQ

Atome Classification :

(39 SA) .........10........20........30....--...-.40.-.....-..50.........-60........70........80........90....---....100.......110.......120.......130.......140.......150.......160.......170.......180.......190...--....200.......210.......220...---.--.--.--.230.......240..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MQLKDKNIFITGSSRGIGLAIAHQFAQLGANIVLN--GRS-EISE-DLIAE-FAD-YGVKVIAIS-GDVSSFEDANRMIKEAIASLGSVDVLVNNAGITNDK---LMLKMTVEDFESVLKINLTGAFNMTQSVLKPMTKARQGAIINISSVVGLTGNVGQANYAASKAGLIGFTKSVAREVAARGIRVNAIAPGFIESDMTDVIP--EKMQEAILAQIPMKRIGKGKEVAQVASFLA---E--Q--E--YLTGQVIAIDGGMTMQ
81 PsiBlast_CBE 86.7845%-102 - C1 -4BO0 FABG_PSEAE C:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRD------------EWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVG------QTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
86 PsiBlast_CBE 86.1645%-104 - C1 -4BNZ FABG_PSEAE B:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRD-----------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVV-----AGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
25 PsiBlast_CBE 86.1049% -92 - C1 -2PNF FABG_AQUAE B:[3-247] IKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIIT--GTSGERAK-AVAEE-IANKYGVKAHGVE-MNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDK---LFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLS--EEIKQKYKEQIPLGRFGSPEEVANVVLFLC---S--ELAS--YITGEVIHVNGGMF--
58 PsiBlast_CBE 85.8045%-107 - C1 -4BO7 FABG_PSEAE B:[24-268] -SLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGI---------------EWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVV-----AGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
62 PsiBlast_CBE 85.5245%-106 - C1 -4BO6 FABG_PSEAE B:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGIT-------------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVV-----AGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
101 PsiBlast_CBE 84.8745%-104 - C1 -4BNV FABG_PSEAE B:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGI---------------EWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVG-----GQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYM-
87 PsiBlast_CBE 84.6345%-104 - C1 -4BNZ FABG_PSEAE A:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAG-----------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
5 PsiBlast_PDB 84.5349% -91 - C1 -2P68 - FABG_AQUAE A:[3-247] IKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIIT--GTSGERAK-AVAEE-IANKYGVKAHGVE-MNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDK---LFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLS--EEIKQKYKEQIPLGRFGSPEEVANVVLFLC---S--ELAS--YITGEVIHVNGGMF--
24 PsiBlast_CBE 84.4748% -87 - C1 -3SJ7 ? B:[11-252] -----KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSK-EKAE-AVVEE-IKA-KGVDSFAIQ-ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDN---LLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD-TDALS--DELKEQMLTQIPLARFGQDTDIANTVAFLASD-K--A--K--YITGQTIHVNGGMYM-
97 PsiBlast_CBE 84.3945%-100 - C1 -4BNW FABG_PSEAE B:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRD------------EWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVV-----AGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
92 PsiBlast_CBE 84.2945%-105 - C1 -4BNX FABG_PSEAE D:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAG-----------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
91 PsiBlast_CBE 84.0645% -99 - C1 -4BNY FABG_PSEAE A:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNA------------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
74 PsiBlast_CBE 83.7345%-105 - C1 -4BO2 FABG_PSEAE D:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGI----------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
57 PsiBlast_CBE 83.6545%-102 - C1 -4BO7 FABG_PSEAE C:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRD------------EWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
71 PsiBlast_CBE 83.5045%-101 - C1 -4BO3 FABG_PSEAE C:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRD-----------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVG---NAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
4 PsiBlast_PDB 83.2649% -91 - C1 -2PNF FABG_AQUAE A:[3-247] IKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIIT--GTSGERAK-AVAEE-IANKYGVKAHGVE-MNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDK---LFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLS--EEIKQKYKEQIPLGRFGSPEEVANVVLFLC---S--ELAS--YITGEVIHVNGGMF--
54 PsiBlast_CBE 83.2145%-101 - C1 -4BO8 FABG_PSEAE C:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAG---------------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVG----AGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
61 PsiBlast_CBE 83.0545% -96 - C1 -4BO6 FABG_PSEAE C:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRD------------EWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIG---GAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
59 PsiBlast_CBE 82.8545%-104 - C1 -4BO7 FABG_PSEAE A:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNA--------------KDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
77 PsiBlast_CBE 82.7445%-104 - C1 -4BO2 FABG_PSEAE A:[23-268] MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGT--ATS-ASGA-EKIAETLKA-NGVEGAGLV-LDVSSDESVAATLEHIQQHLGQPLIVVNNAG----------------EWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELP--EAQREALLGQIPLGRLGQAEEIAKVVGFLA---S--DGAA--YVTGATVPVNGGMYMS
22 PsiBlast_CBE 81.3750% -94 - C1 -4JRO ? C:[25-271] MTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSP-EAAE-ETAKL-VAE-HGVEVEAMK-ANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDN---LLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLD--EKTKEAMLAQIPLGAYGTTEDIANAVLFLA---S--DASK--YITGQTLSVDGGMVM-
12 PsiBlast_PDB 81.2646% -86 - C1 -3OSU FABG_STAAM A:[5-243] -----KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSK-EKAE-AVVEE-IKA-KGVDSFAIQ-ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDN---LLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALS--DELKEQMLTQIPLARFGQDTDIANTVAFLASD-K--A--K--YITGQTIHVNGGMYM-
21 PsiBlast_CBE 79.1950% -87 - C1 -4JRO ? D:[25-271] MTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSP-EAAE-ETAKL-VAE-HGVEVEAMK-ANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDN---LLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMT---D--EKTKEAMLAQIPLGAYGTTEDIANAVLFLA---S--DASK--YITGQTLSVDGGMVM-
17 PsiBlast_PDB 78.5647% -93 - C1 -1EDO FABG1_BRANA A:[4-244] -------VVVTGASRGIGKAIALSLGKAGCKVLVNY-ARSAKAAE-EVSKQ-IEA-YGGQAITFG-GDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDT---LLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLG--EDMEKKILGTIPLGRTGQPENVAGLVEFLALSPA--A--S--YITGQAFTIDGGIAI-
3 PsiBlast_PDB 77.6648% -86 - C1 -3SJ7 ? A:[11-252] -----KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSK-EKAE-AVVEE-IKA-KGVDSFAIQ-ANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDN---LLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMT------DELKEQMLTQIPLARFGQDTDIANTVAFLASD-K--A--K--YITGQTIHVNGGMYM-
23 PsiBlast_CBE 76.3150% -90 - C1 -4JRO ? B:[25-271] MTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSP-EAAE-ETAKL-VAE-HGVEVEAMK-ANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDN---LLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTD-----------KEAMLAQIPLGAYGTTEDIANAVLFLA---S--DASK--YITGQTLSVDGGMVM-
46 PsiBlast_CBE 75.2345% -84 - C1 -4NBU ? B:[10-250] -RLQDKVAIITGAANGIGLEAARVFMKEGAKVVI-----A-DFNE-AAGKE-AVE-ANPGVVFIR-VDVSDRESVHRLVENVAERFGKIDILINNAGITRDS---MLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVP--EKVIEKMKAQVPMGRLGKPEDIANAYLFLASH-E--S--D--YVNGHVLHVDGGIMM-
26 PsiBlast_CBE 72.1346% -94 - C1 -4WK6 ? D:[8-249] MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGT--ATS-ESGA-QAISD-YLG-DNGKGMAL---NVTNPESIEAVLKAITDEFGGVDILVNNAGIT------LLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVAS---------QANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALN--DEQRTATLAQVPAGRLGDPREIASAVAFLA---S--P--EAAYITGETLHVNGGMY--
31 PsiBlast_CBE 71.3946% -82 - C1 -4I08 FABG_VIBCH B:[8-250] MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGT--ATS-ESGA-QAISD-YLG-DNGKGMAL---NVTNPESIEAVLKAITDEFGGVDILVNNAGITRDN---LLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIET--TKALN--DEQRTATLAQVPAGRLGDPREIASAVAFLA---S--P--EAAYITGETLHVNGGMYMI
32 PsiBlast_CBE 70.8846% -85 - C1 -3RSH FABG_VIBCH B:[8-250] MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGT--ATS-ESGA-QAISD-YLG-DNGKGMAL---NVTNPESIEAVLKAITDEFGGVDILVNNAGITRDN---LLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTK-LN--DEQRTATLAQVPAGRLGDPREIASAVAFLA---S--P--EAAYITGETLHVNGGMYMI
11 PsiBlast_PDB 70.6846% -82 - C1 -3RRO FABG_VIBCH A:[8-250] MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGT--ATS-ESGA-QAISD-YLG-DNGKGMAL---NVTNPESIEAVLKAITDEFGGVDILVNNAGITRDN---LLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALN--DEQRTATLAQVPAGRLGDPREIASAVAFLA---S--P--EAAYITGETLHVNGGMYMI
10 PsiBlast_PDB 69.3946% -81 - C1 -3RSH FABG_VIBCH A:[8-250] MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGT--ATS-ESGA-QAISD-YLG-DNGKGMAL---NVTNPESIEAVLKAITDEFGGVDILVNNAGITRDN---LLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTK-----DEQRTATLAQVPAGRLGDPREIASAVAFLA---S--P--EAAYITGETLHVNGGMYMI
33 PsiBlast_CBE 69.2846% -82 - C1 -3RRO FABG_VIBCH B:[8-250] MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGT--ATS-ESGA-QAISD-YLG-DNGKGMAL---NVTNPESIEAVLKAITDEFGGVDILVNNAGITRDN---LLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALN--DEQRTATLAQVPAGRLGDPREIASAVAFLA---S--P--EAAYITGETLHVNGGMYMI
28 PsiBlast_CBE 68.5946% -92 - C1 -4WK6 ? B:[8-249] MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGT--ATS-ESGA-QAISD-YLG-DNGKGMAL---NVTNPESIEAVLKAITDEFGGVDILVNNAGITRDN---LLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVASVVGTM----QANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALN--DEQRTATLAQVPAGRLGDPREIASAVAFLA---S--P--EAAYITGETLHVNGGMY--