@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs1445: (2015-12-08 )
MSKQYDYIVIGGGSAGSGTANRAAMYGAKVLLIEGGQVGGTCVNLGCVPKKIMWYGAQVSETLHKYSSGYGFEVNNLNFDFTTLKANRDAYVQRSRQSYAANFERNGVEKIDGFARFIDNHTIEVNGQQYKAPHITIATGGHPLYPDIIGSELGETSDDFFGWETLPDSILIVGAGYIAAELAGVVNELGVETHLAFRKDHILRGFDDMVTSEVMAEMEKSGISLHANHVPKSLKRDEGGKLIFEAENGKTLVVDRVIWAIGRGPNVDMGLENTDIVLNDKGYIKTDEFENTSVDGVYAIGDVNGKIALTPVAIAAGRRLSERLFNHKDNEKLDYHNVPSVIFTHPVIGTVGLSEAAAIEQFGEDNIKVYTSTFTSMYTAVTTNRQAVKMKLITLGKEEKVIGLHGVGYGIDEMIQGFSVAIKMGATKADFDDTVAIHPTGSEEFVTMR

Atome Classification :

(65 SA) .........10.....-...20......-...30...---------.---------.---------.----------.---------.40........50........60.......--.70...--.--.-...80......-------..90........100-.-....-..110.......---120-..----.--.-----.---------...130----...-----------..-----...140....---...--150........160......---------.170.......180.....---.-.---190--........200.......210.......220.......230.......240.--.---....---.------250.-----..------.--------------.....260...-..-.-.-270........-280.-......290.......300-----.-.-.----.---.-.-.310.......320.......330--........340.......350.......360...-....370..--..-.--..380---.-.-.-....----390.......-400........410.......420.......430.......---440.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSKQYDYIVIGGGSAG-SGTA-NRAAMY-GAKVLLIE---------G---------G---------Q----------V---------GGTCVNLGCVPKKIMWYGAQVSETLHKYSS--GYGFEV--N--N-LNFDFTTLKAN-------RDAYVQRSRQSYAAN-F-ERNG-VEKIDGFARFID---NH--TI----E--V-----N---------GQQYK-----APH-----------IT-----IATGGHPLYP---DII--GS-ELGETSDDFFGWETLPD---------SILIVGAGYIAAELAGVVN---E-L---GV---ETHLAFRKDHILRGFDDMVTSEVMAEMEKSGISLHANHVPKSLKRDEGGKLI--F---EAEN---G------K--T-----LV------V--------------DRVIWAIGRGP-NV-D-M-GL-ENTDIVLN-DKGY-IKTDEFENTSVDGVYAIGD-----V-N-G----K---I-A-LTPVAIAAGRRLSERLFNHKDNE---KLDYHNVPSVIFTHPVIGTVGLSEAAAIEQFGED-NIKVYTSTF--TS-M--YTAVT---T-N-R-QAVK----MKLITLGKEE-K-VIGLHGVGYGIDEMIQGFSVAIKMGATKADFDDTVAIHP---TGSEEFVTMR
22 PsiBlast_CBE 92.6155% -87 - C1 -1GER GSHR_ECOLI B:[2-450] -TKHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIAVELAGVIN---G-L---GA---KTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
11 PsiBlast_PDB 92.5150% -92 - C1 -1BWC GSHR_HUMAN A:[20-478] ---SYDYLVIGGGSGG-LASA-RRAAEL-GARAAVVE---------S---------H---------K----------L---------GGTCVNVGCVPKKVMWNTAVHSEFMHDHAD---YGFPS--C--E-GKFNWRVIKEK-------RDAYVSRLNAIYQNN-L-TKSH-IEIIRGHAAFTS---DPKPTI----E--V-----S---------GKKYT-----APH-----------IL-----IATGGMPSTPHESQIP--GA-SLGITSDGFFQLEELPG---------RSVIVGAGYIAVEMAGILS---A-L---GS---KTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMV---TAVP---G------R--L-----PVMTMIPDV--------------DCLLWAIGRVP-NTKD-L-SL-NKLGIQTD-DKGH-IIVDEFQNTNVKGIYAVGD-----V-C-G----K---A-L-LTPVAIAAGRKLAHRLFEYKEDS---KLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIE-NVKTYSTSF--TP-M--YHAVT---K-R-K-TKCV----MKMVCANKEE-K-VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP---TSSEELVTLR
101 HHSearch 91.8255% -90 - C1 -1GES GSHR_ECOLI A:[3-450] --KHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIGVELGGVIN---G-L---GA---KTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREP-ANDN-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
23 PsiBlast_CBE 91.1954% -87 - C1 -1GEU GSHR_ECOLI B:[2-450] -TKHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIGVELGGVIN---G-L---GA---KTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
1 PsiBlast_PDB 91.1855% -87 - C1 -1GER GSHR_ECOLI A:[3-450] --KHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIAVELAGVIN---G-L---GA---KTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
21 PsiBlast_CBE 90.4555% -86 - C1 -1GET GSHR_ECOLI B:[2-450] -TKHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIAVELAGVIN---G-L---GA---KTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
24 PsiBlast_CBE 90.4454% -87 - C1 -1GES GSHR_ECOLI B:[2-450] -TKHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIGVELGGVIN---G-L---GA---KTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
3 PsiBlast_PDB 89.7354% -88 - C1 -1GES GSHR_ECOLI A:[3-450] --KHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIGVELGGVIN---G-L---GA---KTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
2 PsiBlast_PDB 89.5755% -88 - C1 -1GET GSHR_ECOLI A:[3-450] --KHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIAVELAGVIN---G-L---GA---KTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
12 PsiBlast_PDB 89.0450% -91 - C1 -2GH5 GSHR_HUMAN A:[20-478] ---SYDYLVIGGGSGG-LASA-RRAAEL-GARAAVVE---------S---------H---------K----------L---------GGTCVNVGCVPKKVMWNTAVHSEFMHDHAD---YGFPS--C--E-GKFNWRVIKEK-------RDAYVSRLNAIYQNN-L-TKSH-IEIIRGHAAFTS---DPKPTI----E--V-----S---------GKKYT-----APH-----------IL-----IATGGMPSTPHESQIP--GA-SLGITSDGFFQLEELPG---------RSVIVGAGYIAVEMAGILS---A-L---GS---KTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMV---TAVP---G------R--L-----PVMTMIPDV--------------DCLLWAIGRVP-NTKD-L-SL-NKLGIQTD-DKGH-IIVDEFQNTNVKGIYAVGD-----V-C-G----K---A-L-LTPVAIAAGRKLAHRLFEYKEDS---KLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIE-NVKTYSTSF--TP-M--YHAVT---K-R-K-TKCV----MKMVCANKEE-K-VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP---TSSEELVTLR
31 PsiBlast_CBE 88.8650% -89 - C1 -1XAN GSHR_HUMAN A:[3-461] ---SYDYLVIGGGSGG-LASA-RRAAEL-GARAAVVE---------S---------H---------K----------L---------GGTCVNVGCVPKKVMWNTAVHSEFMHDHAD---YGFPS--C--E-GKFNWRVIKEK-------RDAYVSRLNAIYQNN-L-TKSH-IEIIRGHAAFTS---DPKPTI----E--V-----S---------GKKYT-----APH-----------IL-----IATGGMPSTPHESQIP--GA-SLGITSDGFFQLEELPG---------RSVIVGAGYIAVEMAGILS---A-L---GS---KTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMV---TAVP---G------R--L-----PVMTMIPDV--------------DCLLWAIGRVP-NTKD-L-SL-NKLGIQTD-DKGH-IIVDEFQNTNVKGIYAVGD-----V-C-G----K---A-L-LTPVAIAAGRKLAHRLFEYKEDS---KLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIE-NVKTYSTSF--TP-M--YHAVT---K-R-K-TKCV----MKMVCANKEE-K-VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP---TSSEELVTLR
20 PsiBlast_PDB 88.8250% -91 - C1 -3DK4 GSHR_HUMAN A:[20-478] ---SYDYLVIGGGSGG-LASA-RRAAEL-GARAAVVE---------S---------H---------K----------L---------GGTCVNVGCVPKKVMWNTAVHSEFMHDHAD---YGFPS--C--E-GKFNWRVIKEK-------RDAYVSRLNAIYQNN-L-TKSH-IEIIRGHAAFTS---DPKPTI----E--V-----S---------GKKYT-----APH-----------IL-----IATGGMPSTPHESQIP--GA-SLGITSDGFFQLEELPG---------RSVIVGAGYIAVEMAGILS---A-L---GS---KTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMV---TAVP---G------R--L-----PVMTMIPDV--------------DCLLWAIGRVP-NTKD-L-SL-NKLGIQTD-DKGH-IIVDEFQNTNVKGIYAVGD-----V-C-G----K---A-L-LTPVAIAAGRKLAHRLFEYKEDS---KLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIE-NVKTYSTSF--TP-M--YHAVT---K-R-K-TKCV----MKMVCANKEE-K-VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP---TSSEELVTLR
114 HHSearch 88.5351% -86 - C1 -3DK9 GSHR_HUMAN A:[18-478] -VASYDYLVIGGGSGG-LASA-RRAAEL-GARAAVVE---------S---------H---------K----------L---------GGTCVNVGCVPKKVMWNTAVHSEFM-HDHA--DYGFPS--C--E-GKFNWRVIKEK-------RDAYVSRLNAIYQNN-L-TKSH-IEIIRGHAAFTSDP-KP--TI----E--V-----S---------GKKYT-----APH-----------IL-----IATGGMPSTPHESQIP--GA-SLGITSDGFFQLEELPG---------RSVIVGAGYIAVEMAGILS---A-L---GS---KTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSG-LE--VSMVTAVP---GRLPVMTM--I-----PD------V--------------DCLLWAIGRVP-NTKD-L-SL-NKLGIQTD-DKGH-IIVDEFQNTNVKGIYAVGD-----V-C-G----K---A-L-LTPVAIAAGRKLAHRLFEYKEDS---KLDYNNIPTVVFSHPPIGTVGLTEDEAIHKY-GIENVKTYSTSF--TP-M--YHAVT---K-R-K-TKCV----MKMVCANKEE-K-VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP---TSSEELVTLR
4 PsiBlast_PDB 87.8354% -87 - C1 -1GEU GSHR_ECOLI A:[3-450] --KHYDYIAIGGGSGG-IASI-NRAAMY-GQKCALIE---------A---------K---------E----------L---------GGTCVNVGCVPKKVMWHAAQIREAIHMYGP--DYGFDT--T--I-NKFNWETLIAS-------RTAYIDRIHTSYENV-L-GKNN-VDVIKGFARFVD---AK--TL----E--V-----N---------GETIT-----ADH-----------IL-----IATGGRPSHP---DIP--GV-EYGIDSDGFFALPALPE---------RVAVVGAGYIGVELGGVIN---G-L---GA---KTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLT--L---ELED---G------R--S-----ET------V--------------DCLIWAIGREPAND-N-I-NL-EAAGVKTN-EKGY-IVVDKYQNTNIEGIYAVGD-----N-T-G----A---V-E-LTPVAVAAGRRLSERLFNNKPDE---HLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDD-QVKVYKSSF--TA-M--YTAVT---T-H-R-QPCR----MKLVCVGSEE-K-IVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHP---TAAEEFVTMR
28 PsiBlast_CBE 87.7650% -89 - C1 -3DK8 GSHR_HUMAN A:[20-478] ---SYDYLVIGGGSGG-LASA-RRAAEL-GARAAVVE---------S---------H---------K----------L---------GGTCVNVGCVPKKVMWNTAVHSEFMHDHAD---YGFPS--C--E-GKFNWRVIKEK-------RDAYVSRLNAIYQNN-L-TKSH-IEIIRGHAAFTS---DPKPTI----E--V-----S---------GKKYT-----APH-----------IL-----IATGGMPSTPHESQIP--GA-SLGITSDGFFQLEELPG---------RSVIVGAGYIAVEMAGILS---A-L---GS---KTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMV---TAVP---G------R--L-----PVMTMIPDV--------------DCLLWAIGRVP-NTKD-L-SL-NKLGIQTD-DKGH-IIVDEFQNTNVKGIYAVGD-----V-C-G----K---A-L-LTPVAIAAGRKLAHRLFEYKEDS---KLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIE-NVKTYSTSF--TP-M--YHAVT---K-R-K-TKCV----MKMVCANKEE-K-VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP---TSSEELVTLR
25 PsiBlast_CBE 87.7550% -87 - C1 -3SQP GSHR_HUMAN B:[20-478] ---SYDYLVIGGGSGG-LASA-RRAAEL-GARAAVVE---------S---------H---------K----------L---------GGTCVNVGCVPKKVMWNTAVHSEFMHDHAD---YGFPS--C--E-GKFNWRVIKEK-------RDAYVSRLNAIYQNN-L-TKSH-IEIIRGHAAFTS---DPKPTI----E--V-----S---------GKKYT-----APH-----------IL-----IATGGMPSTPHESQIP--GA-SLGITSDGFFQLEELPG---------RSVIVGAGYIAVEMAGILS---A-L---GS---KTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMV---TAVP---G------R--L-----PVMTMIPDV--------------DCLLWAIGRVP-NTKD-L-SL-NKLGIQTD-DKGH-IIVDEFQNTNVKGIYAVGD-----V-C-G----K---A-L-LTPVAIAAGRKLAHRLFEYKEDS---KLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIE-NVKTYSTSF--TP-M--YHAVT---K-R-K-TKCV----MKMVCANKEE-K-VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP---TSSEELVTLR