@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs1448: (2015-12-08 )
MQVEVDLPNHSYHIKIEEGCFSEAGDWVSHLWQKQMITIITDSNVEILYGESLVNQLKKQGFTVHVFSFAAGEASKTLEVANRIYGFLAKHHMTRSDGIIALGGGVVGDLAAFVASTYMRGIHFLQIPTSLTAQVDSSIGGKTGVNTSFAKNMVGTFAQPDGVLIDPVTLKTLGNRELVEGMGEVIKYGLIDDIKLWHILEEMDGTIDSILDSALAIIYHSCQVKRKHVLADQYDKGLRMHLNFGHTIGHAIEVHAGYGEIMHGEAVAIGMIQLSRVAERKNLMPRGISQDIYNMCLKFGLPVHYAEWDKDVLFDILSHDKKASGQFIKIVILPQLGSATVHQIPLEEMRDYLEK

Atome Classification :

(33 SA) .........10........20.--.-......30........40........50........60.------..------.------...--.70....---....80........90.--..--.....100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200--....-.--..210-------------..-------..---------------.-...220.......230.......240.......250.......260.......270.......280.......290.....-..300...-.-----------.-----------.-----------.310..-.....---320.-----......330.....-..340--.------..-------.....350...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MQVEVDLPNHSYHIKIEEGCFS--E-AGDWVSHLWQKQMITIITDSNVEILYGESLVNQLKKQGF------TV------H------VFS--FAAGEAS---KTLEVANRIYGFLAKHH--MT--RSDGIIALGGGVVGDLAAFVASTYMRGIHFLQIPTSLTAQVDSSIGGKTGVNTSFAKNMVGTFAQPDGVLIDPVTLKTLGNRELVEGMGEVIKYGLIDDIKLWHILEE--MDGT-I--DSIL--------------DS-------AL---------------A-IIYHSCQVKRKHVLADQYDKGLRMHLNFGHTIGHAIEVHAGYGEIMHGEAVAIGMIQLSRVAERKNLMPRGISQDIYNMCL-KFGLPVHY-A-----------E-----------W-----------DKDVLF-DILSH---DKKA-----SGQFIKIVILPQLG-SATV---H------QI-------PLEEMRDYLEK
21 PsiBlast_CBE 97.2039%-111 - C3 -3OKF AROB_VIBCH B:[32-376] -RITVNLGERSYPISIGAGLF-----ANPALLSLSAKQKVVIVTNHTVAPLYAPAIISLLDHIGC------QH------A------LLE--LPDGEQY---KTLETFNTVMSFLLEHN--YS--RDVVVIALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDSAFFDWLEA--QMEA-L--YALD--------------EQ-------AL---------------TYAIARCCQIKAEVVAQDEKESGIRALLNLGHTFGHAIEAHMGYGNWLHGEAVSAGTVMAAKTAQLQGLIDASQFERILAILK-KAHLPVRT-P-----------E------------------------NMTFA-DFMQHMMR---------------LVLPTSIGTSAVV---K------GV-------PEAVIAQAIEY
49 HHSearch 96.8538%-110 - C3 -3OKF AROB_VIBCH A:[36-385] -----NLGERSYPISIGAGLFA--N--PALLSL-SAKQKVVIVTNHTVAPLYAPAIISLLDHIGC------QH------A------LLE--LPDGEQY---KTLETFNTVMSFLLEHN--YS--RDVVVIALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDSAFFDWLEA--QMEA-LY-ALDE--------------QA-------LT---------------Y-AIARCCQIKAEVVAQDEK--GIRALLNLGHTFGHAIEAHMGYGNWLHGEAVSAGTVMAAKTAQLQGLIDASQFERILAILK-KAHLPVRT-P-----------EN----------M-----------TFADFM-QHMMR---DKKV-----LAGELRLVLPTSIG-TSAVV--K------GV-------PEAVIAQAIEY
1 PsiBlast_PDB 95.8539%-107 - C3 -3OKF AROB_VIBCH A:[32-376] -RITVNLGERSYPISIGAGLF-----ANPALLSLSAKQKVVIVTNHTVAPLYAPAIISLLDHIGC------QH------A------LLE--LPDGEQY---KTLETFNTVMSFLLEHN--YS--RDVVVIALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDSAFFDWLEA--QMEA-L--YALD--------------EQ-------AL---------------TYAIARCCQIKAEVVAQDEK--GIRALLNLGHTFGHAIEAHMGYGNWLHGEAVSAGTVMAAKTAQLQGLIDASQFERILAILK-KAHLPVRT-P-----------E------------------------NMTFA-DFMQHMMRDKKV-----LAGELRLVLPTSIGTSAVV---K------GV-------PEAVIAQAIEY
53 HHSearch 90.9636%-106 * C3 *1SG6 ARO1_EMENI A:[9-392] -------ILGRESIIADFGLWRNYV-AKDLISDC-SSTTYVLVTDTNIGSIYTPSFEEAFRKRAA------EITPSPRLL------IYN--RPPGEVS---KSRQTKADIEDWMLSQNPPCG--RDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEE--NAET-IL-KAVRREVTPGEHRFEGTEEI-------LK---------------A-RILASARHKAYVVSA-----GLRNLLNWGHSIGHAIEAILT-PQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLA-AYGLPTSL-K-----------D-----------ARIRKLTAGKHCSVDQLM-FNMAL---DKK------------IVLLSAIG-TPYE---TRAS---VV-------ANEDIRVVLA-
39 Fugue 89.6534%-102 - C3 -1DQS ARO1_EMENI A:[4-391] -PTKISI-LGRESIIADFGLWR--NYVAKDLISDCSSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPSPRL------L------IYN--RPPGEVS---KSRQTKADIEDWMLSQNPPCG--RDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEE--NAET-I--LKAVRRRFEGTE------EI-------LK---------------A-RILASARHKAYVVSADEREGGLRNLLNWGHSIGHAIEAILTP-QILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLA-AYGLPTSL-KDARIRKLTAGKH-----------C-----------SVDQLM-FNMAL---DKKN-----DGPKKKIVLLSAIG-TPYETRAS------VV-------ANEDIRVVL--
23 PsiBlast_CBE 89.6337%-102 - C3 -3ZOK DHQS_ACTCH C:[17-350] --VDVDLGDRSYPIYIGSGLLD--Q-PDLLQRHVHGKRVL-VVTNSTVAPIYLDKVVGALTNENP------NV------S------VESVILPDGEKY---KNMDTLMKVFDKAIESR--LD--RRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEK--NMPA-L--MARD--------------PS-------AL---------------AYAIKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRLGWIDESIVNRAHNILQ-QAKLPTAP-P-----------E-----------T-----------MTVEMFKSVMAV---DKKV-----ADGLLRLILLKGPL-GNCV---F------TG-------DYDRKALDETL
2 PsiBlast_PDB 89.0237%-101 - C3 -3ZOK DHQS_ACTCH A:[17-350] --VDVDLGDRSYPIYIGSGLLD--Q-PDLLQRHVHGKRVL-VVTNSTVAPIYLDKVVGALTNENP------NV------S------VESVILPDGEKY---KNMDTLMKVFDKAIESR--LD--RRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEK--NMPA-L--MARD--------------PS-------AL---------------AYAIKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRLGWIDESIVNRAHNILQ-QAKLPTAP-P-----------E-----------T-----------MTVEMFKSVMAV---DKKV-----ADGLLRLILLKGPL-GNCV---F------TG-------DYDRKALDETL
22 PsiBlast_CBE 88.0137%-105 - C3 -3ZOK DHQS_ACTCH D:[17-350] --VDVDLGDRSYPIYIGSGLLD--Q-PDLLQRHVHGKRVL-VVTNSTVAPIYLDKVVGALTNENP------NV------S------VESVILPDGEKY---KNMDTLMKVFDKAIESR--LD--RRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEK--NMPA-L--MARD--------------PS-------AL---------------AYAIKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRLGWIDESIVNRAHNILQ-QAKLPTAP-P-----------E-----------T-----------MTVEMFKSVMAV---DKKV-----ADGLLRLILLKGPL-GNCV---F------TG-------DYDRKALDETL
24 PsiBlast_CBE 87.7737%-103 - C3 -3ZOK DHQS_ACTCH B:[17-350] --VDVDLGDRSYPIYIGSGLLD--Q-PDLLQRHVHGKRVL-VVTNSTVAPIYLDKVVGALTNENP------NV------S------VESVILPDGEKY---KNMDTLMKVFDKAIESR--LD--RRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDANFFEWQEK--NMPA-L--MARD--------------PS-------AL---------------AYAIKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRLGWIDESIVNRAHNILQ-QAKLPTAP-P-----------E-----------T-----------MTVEMFKSVMAV---DKKV-----ADGLLRLILLKGPL-GNCV---F------TG-------DYDRKALDETL
54 HHSearch 85.0228%-101 - C3 -3QBE AROB_MYCTU A:[19-364] ------AVDPPYPVVIGTGLLD--E-LEDLLAD---RHKVAVVHQPGLAE-TAEEIRKRLAGKGV------DA------H------RIE--IPDAEAGKDLPVVGFIWEVLGRIGI-----G--RKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVILDLIEA--DPQAALD-PAGD--------------VL-------PE---------------L-IRRAITVKAEVV-AA----SELREILNYGHTLGHAIERRER-YRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILS-SLGLPVSY-D-----------P-----------D-----------ALPQLL-EIMAG---DKKT-----RAGVLRFVVLDGLA-KPGRM--V------GP-------DPGLLVTAYAG
27 PsiBlast_CBE 84.7134%-109 - C3 -1SG6 ARO1_EMENI B:[41-373] -----------------------------------------LVTDTNIGSIYTPSFEEAFRKRAA------EI------TPSPRLLIYN--RPPGEVS---KSRQTKADIEDWMLSQN--PPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEE--NAET-I--LKAV--------------RR-------EVTPGEHRFEGTEEILKA-RILASARHKAYVVSA----GGLRNLLNWGHSIGHAIEAIL-TPQILHGECVAIGMVKEAELARHLGIL-KGVAVSRIVKCLAAYGLPTSL-K-----------DARIRKLTAGKHC-----------SVDQLM-FNMAL----------------KKIVLLSAIG-TPYE---T------RA-------SVVANEDIRVV
11 PsiBlast_PDB 84.5234%-108 - C3 -1NVA ARO1_EMENI A:[41-373] -----------------------------------------LVTDTNIGSIYTPSFEEAFRKRAA------EI------TPSPRLLIYN--RPPGEVS---KSRQTKADIEDWMLSQN--PPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEE--NAET-I--LKAV--------------RR-------EVTPGEHRFEGTEEILKA-RILASARHKAYVVSA----GGLRNLLNWGHSIGHAIEAIL-TPQILHGECVAIGMVKEAELARHLGIL-KGVAVSRIVKCLAAYGLPTSL-K-----------DARIRKLTAGKHC-----------SVDQLM-FNMAL---D----------PKKKIVLLSAIG-TPYE---T------RA-------SVVANEDIRVV
36 PsiBlast_CBE 84.5034%-109 - C3 -1NRX ARO1_EMENI B:[41-373] -----------------------------------------LVTDTNIGSIYTPSFEEAFRKRAA------EI------TPSPRLLIYN--RPPGEVS---KSRQTKADIEDWMLSQN--PPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEE--NAET-I--LKAV--------------RR-------EVTPGEHRFEGTEEILKA-RILASARHKAYVVSAD---GGLRNLLNWGHSIGHAIEAIL-TPQILHGECVAIGMVKEAELARHLGIL-KGVAVSRIVKCLAAYGLPTSL-K-----------DARIRKLTAGKHC-----------SVDQLM-FNMAL---D----------PKKKIVLLSAIG-TPYE---T------RA-------SVVANEDIRVV
15 PsiBlast_PDB 84.3934%-108 - C3 -1SG6 ARO1_EMENI A:[41-373] -----------------------------------------LVTDTNIGSIYTPSFEEAFRKRAA------EI------TPSPRLLIYN--RPPGEVS---KSRQTKADIEDWMLSQN--PPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEE--NAET-I--LKAV--------------RR-------EVTPGEHRFEGTEEILKA-RILASARHKAYVVSA-----GLRNLLNWGHSIGHAIEAIL-TPQILHGECVAIGMVKEAELARHLGIL-KGVAVSRIVKCLAAYGLPTSL-K-----------DARIRKLTAGKHC-----------SVDQLM-FNMAL---D------------KKIVLLSAIG-TPYE---T------RA-------SVVANEDIRVV