@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs1531: (2015-12-08 )
MIDRKDTNRFKLVSKYSPSGDQPQAIETLVDNIEGGEKAQILKGATGTGKTYTMSQVIAQVNKPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYYDYYQPEAYVPSSDTYIEKDSSVNDEIDKLRHSATSSLLERNDVIVVASVSCIYGLGSPKEYADSVVSLRPGQEISRDQLLNNLVDIQFERNDIDFQRGKFRVRGDVVEVFPASRDEHAFRIEFFGDEIDRIREIESLTGRVLGEVEHLAIFPATHFMTNDEHMEEAISKIQAEMENQVELFEKEGKLIEAQRIRQRTEYDIEMLREMGYTNGVENYSRHMDGRSEGEPPFTLLDFFPEDFLIMIDESHMTMGQIKGMYNGDRSRKEMLVNYGFRLPSALDNRPLRREEFESHVHQIVYVSATPGDYEMEQTDTVVEQIIRPTGLLDPEVEVRPSMGQMDDLLGEINLRTEKGERTFITTLTKRMAEDLTDYLKEMGVKVKYMHSDIKTLERTEIIRDLRLGVFDVLIGINLLREGIDVPEVSLVAILDADKEGFLRNERGLIQTIGRAARNSNGHVIMYADKITDSMQRAMDETARRRRLQMDYNEKHGIVPQTIKKEIRDLIAITKSNDSDKPEKVVDYSSLSKKERQAEIKALQQQMQEAAELLDFELAAQIRDVILELKAID

Atome Classification :

(20 SA) .........10........20........30........40........50........60.-.----.--.....70........80.....--...90......----..100.......110.......120.......130.......140......-.150.......160-.......170.--......180.......190.......200..-.....210.......220.......230........240.......250.......260.......270.......280.......290.......300.......310.......320.......330.....-..340.......350.......360......-.370.......380.......390........--.400.......410........420.......-430.......440.......450.......460.......470.......480...-......490.......500.......510.......520.-------......530.......540......-.550.......560.......570....-...580.......590.......600.......610.......620.......630----.......640.......650.......660.-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MIDRKDTNRFKLVSKYSPSGDQPQAIETLVDNIEGGEKAQILKGATGTGKTYTMSQVIAQVN-K----P--TLVIAHNKTLAGQLYGEFKEFF--PDNAVEYFVSY----YDYYQPEAYVPSSDTYIEKDSSVNDEIDKLRHSATSSLLERNDVIVVASVS-CIYGLGSPKEYADS-VVSLRPGQEIS--RDQLLNNLVDIQFERNDIDFQRGKFRVRGDV-VEVFPASRDEHAFRIEFFGDEIDRIR-EIESLTGRVLGEVEHLAIFPATHFMTNDEHMEEAISKIQAEMENQVELFEKEGKLIEAQRIRQRTEYDIEMLREMGYTNGVENYSRHMDGRSEGEPPFTLLDFFPED-FLIMIDESHMTMGQIKGMYNGDRSRKEMLVN-YGFRLPSALDNRPLRREEFESH--VHQIVYVS--ATPGDYEMEQTDT-VVEQIIRPTGLLDPEVEV-RPSMGQMDDLLGEINLRTEKGERTFITTLTKRMAEDLTDYLKEMGVKVKYM--HSD-IKTLERTEIIRDLRLGVFDVLIGINLLREGIDVPEVSLVA-------ILDADKEGFLRNERGLIQTIGRAAR-NSNGHVIMYADKITDSMQRAMDETARRR-RLQMDYNEKHGIVPQTIKKEIRDLIAITKSNDSDKPEKVVDYSSLSKKERQAEIKA----LQQQMQEAAELLDFELAAQIRDVILELKAID-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
54 HHSearch 90.5168% -91 - C4 -2D7D UVRB_BACSU A:[3-654] -------DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVN-K----P--TLVIAHNKTLAGQLYSEFKEFF--PNNAVEYFVSY----YDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVS-CIYGLGSPEEYREM-VVSLRTEMEIE--RNELLRKLVDIQYARNDIDFQRGTFRVRGDV-VEIFPASRDEHCVRVEFFGDEIERIR-EVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDD-FMIVVDESHVTIPQVRGMFNGDQARKQVLVD-HGFRLPSALDNRPLRFEEFEKH--MHNIVYVS--ATPGPYEIEHTDE-MVEQIIRPTGLLDPLIDV-RPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NAEGRVIMYADKITKSMEIAINETKRRR-EQQERFNEEHGITPKTIN----------------------------KKERQKVVEQ----MEHEMKEAAKALDFERAAELRDLL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 90.2067% -91 - C4 -2D7D UVRB_BACSU A:[3-654] -------DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVN-K----P--TLVIAHNKTLAGQLYSEFKEFF--PNNAVEYFVSY----YDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVS-CIYGLGSPEEYREM-VVSLRTEMEIE--RNELLRKLVDIQYARNDIDFQRGTFRVRGDV-VEIFPASRDEHCVRVEFFGDEIERIR-EVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDD-FMIVVDESHVTIPQVRGMFNGDQARKQVLVD-HGFRLPSALDNRPLRFEEFEKH--MHNIVYVS--ATPGPYEIEHTDE-MVEQIIRPTGLLDPLIDV-RPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NAEGRVIMYADKITKSMEIAINETKRRR-EQQERFNEEHGITPKTIN----------------------------KKERQKVVEQ----MEHEMKEAAKALDFERAAELRDLL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 89.2267% -89 - C4 -2NMV ? A:[3-654] -------DRFELV-KYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVN-K----P--TLVIAHNKTLAGQLYSEFKEFF--PNNAVEYFVSY----YDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVS-CIYGLGSPEEYREM-VVSLRTEMEIE--RNELLRKLVDIQYARNDIDFQRGTFRVRGDV-VEIFPASRDEHCVRVEFFGDEIERIR-EVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDD-FMIVVDESHVTIPQVRGMFNGDQARKQVLVD-HGFRLPSALDNRPLRFEEFEKH--MHNIVYVS--ATPGPYEIEHTDE-MVEQIIRPTGLLDPLIDV-RPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NAEGRVIMYADKITKSMEIAINETKRRR-EQQERFNEEHGITPKTIN----------------------------KKERQKVVEQ----MEHEMKEAAKALDFERAAELRDLL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 88.0068% -91 - C4 -1T5L UVRB_BACCA B:[3-595] -------GRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYAQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDIDFRRGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIERIR-EVDALTGEVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRDV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 87.6868% -89 - C4 -3UWX - ? B:[26-620] -----VEGRFQLVSPYEPQGDQPQAIAKLVDGLRLGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLHSELKEFF--PHNAVEYFVSY----YDYYQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDIDFRRGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIERIR-EVDALTGEVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYIS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIHERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRDV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 87.5668% -89 - C4 -1T5L UVRB_BACCA A:[3-595] -------GRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYAQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDIDFRRGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIERIR-EVDALTGEVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRDV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 86.4367% -91 - C4 -3V4R UVRB_BACSU A:[9-596] -------DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVN-K----P--TLVIAHNKTLAGQLYSEFKEFF--PNNAVEYFVSY----YDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVS-CIYGLGSPEEYREM-VVSLRTEMEIE--RNELLRKLVDIQYARNDIDFQRGTFRVRGDV-VEIFP--RDEHCVRVEFFGDEIERIR-EVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDD-FMIVVDESHVTIPQVRGMFNGDQARKQVLVD-HGFRLPSALDNRPLRFEEFEKH--MHNIVYVS--ATPGPYEIEHTDE-MVEQIIRPTGLLDPLIDV-RPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NAEGRVIMYADKITKSMEIAINETKRRR-EQQERFNEEHGITPKTINK-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 86.2668% -89 - C4 -2FDC UVRB_BACCA B:[3-593] -------GRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYYQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDIDFRRGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIERIR-EVDALTGEVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--H---------IEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIR--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 86.0167% -91 - C4 -3V4R ? B:[9-595] -------DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVN-K----P--TLVIAHNKTLAGQLYSEFKEFF--PNNAVEYFVSY----YDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVS-CIYGLGSPEEYREM-VVSLRTEMEIE--RNELLRKLVDIQYARNDIDFQRGTFRVRGDV-VEIFPASRDEHCVRVEFFGDEIERIR-EVDALTGEILGDRDHVAIFPAS--------MEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDD-FMIVVDESHVTIPQVRGMFNGDQARKQVLVD-HGFRLPSALDNRPLRFEEFEKH--MHNIVYVS--ATPGPYEIEHTDE-MVEQIIRPTGLLDPLIDV-RPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NAEGRVIMYADKITKSMEIAINETKRRR-EQQERFNEEHGITPKTIN------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
80 Fugue 85.5271% -77 - C4 -1D9X UVRB_BACCA A:[2-595] ------EGRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYYQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDI--FRGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIEA---EVDALTGKVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAARNA-NGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRDV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 84.4568% -78 - C4 -1D9X UVRB_BACCA A:[3-595] -------GRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYYQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDI-F-RGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIE---AEVDALTGKVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRDV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 83.6868% -75 - C4 -1D9Z UVRB_BACCA A:[3-594] -------GRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYYQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDI-F-RGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIE--R-EVDALTGKVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRDV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 83.6368% -86 - C4 -2FDC UVRB_BACCA A:[3-594] -------GRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-K----P--TLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYYQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VV---------------------------------------------------------------------------------------IFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSPG-VVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--H-------ERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRD-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
79 Fugue 81.6858% -81 - C4 -1D2M UVRB_THET8 A:[2-583] --------TFRY-RGPSPKGDQPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALG-R----P--ALVLAPNKILAAQLAAEFRELF--PENAVEYFISY----YDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASVS-AIYGLGDPREYRA--------RNLVV--REVLLERLLELGYQRNDIDLSPGRFRAKGEV-LEIFPAYETE-PIRVEL------------------------GFVLFPATHYLSP-EGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLYDLEMLRVMGTCPGVENYARYFTGKAPGEPPYTLLDYFPED-FLVFLDESHVTVPQLQGMYRGDYARKKTLVD-YGFRLPSALDNRPLRFEEFLER--VSQVVFVS--ATPGPFELAHSGR-VVEQIIRPTGLLDPLVRV-KPTENQILDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGIRARYL--HHE-LDAFKRQALIRDLRLGHYDCLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NARGEVWLYADRVSEAMQRAIEETNRRR-ALQEAYNLEHGITPETV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
81 Fugue 67.5469% -80 - C4 -1D9X UVRB_BACCA A:[2-414] ------EGRFQLVAPYEPQGDQPQAIAKLVDGLRRGVKHQTLLGATGTGKTFTISNVIAQVN-------KPTLVIAHNKTLAGQLYSELKEFF--PHNAVEYFVSY----YDYYQPEAYVPQTDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVS-CIYGLGSPEEYREL-VVSLRVGMEIE--RNALLRRLVDIQYDRNDI--FRGTFRVRGDV-VEIFPASRDEHCIRVEFFGDEIEA---EVDALTGKVLGEREHVAIFPASHFVTREEKMRLAIQNIEQELEERLAELRAQGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDD-FLIIVDESHVTLPQLRGMYNGDRARKQVLVD-HGFRLPSALDNRPLTFEEFEQK--INQIIYVS--ATPGPYELEHSP-GVVEQIIRPTGLLDPTIDV-RPTKGQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYL--HSE-IKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVA-------ILDADKEGFLRSERSLIQTIGRAAR-NANGHVIMYADTITKSMEIAIQETKRRR-AIQEEYNRKHGIVPRTVKKEIRDV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
82 Fugue 49.9320% -50 - C4 -2EYQ MFD_ECOLI A:[5-1150] ----PEQYRYTLPVK---AGEQ-----------------RLLGELTGAACATLVAEIAERHA-G----P--VVLIAPDMQNALRLHDEISQF---TDQMVMNLADWETLPYDSFSP-----------------HQDIISSRLSTLYQLPTMQRGVLIVPVN-TLMQRVCPHSFLHGHALVMKKGQRLS--RDALRTQLDSAGYRHVDQVMEHGEYATRGAL-LDLFPMGS-ELPYRLDFFDDEIDSLR-VFDVDSQRTLEEVEAINLLPAHEFPTDKAAIELFRSQWRDTFE-----------------VKRDPEHIYQQVSKGTLPAGIEYWQPLF----FSEPLPPLFSYFPANTLLVNTGDLETSAERFQADTLARFENRGVDPM-RPLLPPQSLW---LRVDELFSE--LKNWPRVQ--LKTE--HLPTKAA-NANLGFQKLPDLAVQAQQ-KAPLDALRKFL-----ETFDG-PVVFSVESEGRREALGELLARIKIAPQRIMRLDE-ASDRGRYLMIGAAEHGFVD------------TVRNLALIC-------ESDLLGERVARRRQDSRRTINPDTL-IRN------LAELHIGQPVVHLEHGVGR-YAGMTTLEAGGITGEYLMLTY-----------ANDAKLYVPVSSLHLISRYAGGAEENAPLHKLGGDAWSRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIATPPARRLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAIGHGQMRERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKAGREPSLEDLTSQQTEVELRMPSLLPDDFIPDVNTRLSFYKRIASAKTENELEEIKVELIDRFGLLPDPARTLLDIARLRQQAQKLGIRKLEGNEKGGVIEFAEKNHVNPAWLIGLLQKQPQHYRLDGPTRLKFIQDLSERKTRIEWVRQFMRELEENAI
56 HHSearch 46.4819% -54 - C4 -3HJH MFD_ECOLI A:[14-450] ------------------------------------GEQRLLGELTGAACATLVAEIAER-HAG----P--VVLIAPDMQNALRLHDEISQFT--D-QMVM-----------------NLADWETLPYDSFSPHQDIISSRLSTLYQLPTMQRGVLIVPVNTLMQRVCPHSFLHGH-ALVMKKGQRLS--RDALRTQLDSAGYRHVDQVMEHGEYATRGAL-LDLFPMGS-ELPYRLDFFDDEIDSLR-VFDVDSQRTLEEVEAINLLPAHEFPTDKAAIELFRSQWRDTFEVKRD-----------------PEHIYQQVSKGTLPAGIEYWQPLFFSEP----LPPLFSYFPAN-TL-L-VNTGDLETSAERFQADTLARFENRGVDPMR-PLLPPQSLWLRVDELFSELKNWPRVQLKTEHLPTKA-AN------ANLGFQKL----PDLAVQAQQKAPLDALRKFLETF---DGPVVFSVESEGRREALGELLARIKIAPQRI--MRL-----------DEASDRG--RYLMIGAAEHGFVDTVRNLAL-------ICESDLL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
83 Fugue 45.9618% -53 - C4 -3HJH MFD_ECOLI A:[5-450] ---------------------------YRYTLPVKAGEQRLLGELTGAACATLVAEIAERHA-G----P--VVLIAPDMQNALRLHDEISQFT--DQM-----VMN----LADWETLPY-DSFSPHQDIISSRLSTLYQLPTM-------QRGVLIVPVNT-LMQRVCPHSFLHGH-ALVMKKGQRLS--RDALRTQLDSAGYRHVDQVMEHGEYATRGAL-LDLFPMG-SELPYRLDFFDDEIDSLR-VFDVDSQRTLEEVEAINLLPAHEFPTDKAAIELFRSQWRDTFEVKRD----------PEHIYQQVSKGTL-------PAGIEYWQPLF----FSEPLPPLFSYFPAN-TLLVNTGD--LETSAERFQADTLARFENRGV-DPMRPLLPPQSLWLRVDELFSE--LKNWPRVQ--LKTEHLPTKAANA-NLG--FQKLPDLAVQAQQ-KAPLDALRKFLET------FDGPVVFSVESEGRREALGELLARIKIAPQRI--MRL-DEASDR------------GRYLMIGAAEHGFVDTVRNLAL-------ICESDLL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------