@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs1760: (2015-12-10 )
MWPEDRIASFRRTLLGWYDQEKRDLPWRRTTNPYYIWVSEIMLQQTQVNTVIPYYKRFLEWFPQIKDLADAPEEQLLKAWEGLGYYSRVRNMQKAAQQVMVDFGGIFPHTYDDIASLKGIGPYTAGAIASISFNLPEPAVDGNVMRVMARLFEVNYDIGDPKNRKIFQAIMEILIDPDRPGDFNQALMDLGTDIESAKTPRPDESPIRFFNAAYLNGTYSKYPIKNPKKKPKPMRIQAFVIRNQNGQYLLEKNTKGRLLGGFWSFPIIETSPLSQQLDLFDDNQSNPIIWQTQNETFQREYQLKPQWTDNHFPNIKHTFSHQKWTIELIEGVVKATDLPNAPHLKWAAIEDFSLYPFATPQKKMLETYLKQKNA

Atome Classification :

(24 SA) .........10........20...-......30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MWPEDRIASFRRTLLGWYDQ-EKR-DLPWRRTTNPYYIWVSEIMLQQTQVNTVIPYYKRFLEWFPQIKDLADAPEEQLLKAWEGLGYYSRVRNMQKAAQQVMVDFGGIFPHTYDDIASLKGIGPYTAGAIASISFNLPEPAVDGNVMRVMARLFEVNYDIGDPKNRKIFQAIMEILIDPDRPGDFNQALMDLGTDIESAKTPRPDESPIRFFNAAYLNGTYSKYPIKNPKKKPKPMRIQAFVIRNQNGQYLLEKNTKGRLLGGFWSFPIIETSPLSQQLDLFDDNQSNPIIWQTQNETFQREYQLKPQWTDNHFPNIKHTFSHQKWTIELIEGVVKATDLPNAPHLKWAAIEDFSLYPFATPQKKMLETYLKQKNA
4 PsiBlast_PDB 93.9837% -85 - C2 -3G0Q ? A:[5-347] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKM----VKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMV--------GLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
25 HHSearch 93.2337% -82 * C2 *3FSP ? A:[11-361] ----FPAREFQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCETD-GADGKE-------------KLEQMVGEQYGLQVEL-TEPIVSFEHAFSHLVWQLTVFPGRLVHG-GPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS-
6 PsiBlast_PDB 93.1037% -87 - C2 -4YPH ? A:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKM----VKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMV--------GLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
7 PsiBlast_PDB 92.3137% -84 - C2 -1RRQ ? A:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKM----VKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMV--------GLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
3 PsiBlast_PDB 91.8337% -82 - C2 -1VRL ? A:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------D--DGKEKLEQMV--------GLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
48 Fugue 91.7536% -76 - C2 -1RRQ ? A:[12-362] -----PAREFQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELP----VKMVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDG-------------------ADGKEKLEQMVGLQVELTEPIVSFEHAFSHLVWQLTVFPGRLV-HGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS-
5 PsiBlast_PDB 91.5937% -84 - C2 -4YOQ ? A:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKM----VKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMV--------GLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
21 PsiBlast_CBE 91.4737% -80 - C2 -4YPR ? B:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMVG---------QVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
8 PsiBlast_PDB 91.4237% -79 - C2 -4YPR ? A:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMVGE----QYGLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
2 PsiBlast_PDB 91.1637% -82 - C2 -1RRS ? A:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMK---VKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMV--------GLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
1 PsiBlast_PDB 90.8237% -80 - C2 -3FSP ? A:[16-358] ---------FQRDLLDWFAR-ERR-DLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCET----------DGADGKEKLEQMVGE----QYGLQVELTEP-IVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPY-RLAPEDELKAYAFPVSHQRVWREYKEWAS-
16 PsiBlast_PDB 79.2943% -89 - C2 -1WEF MUTY_ECOLI A:[4-225] -------SQFSAQVLDWYDK-YGRATLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK--------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 78.0843% -91 - C2 -1KG3 MUTY_ECOLI A:[4-224] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKP---------------------------------------------------------------------------------------------------------------------------------------------------
27 HHSearch 77.2343% -87 - C2 -1KG2 MUTY_ECOLI A:[2-224] -----QASQFSAQVLDWYDK-YGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKP---------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 77.2342% -88 - C2 -1MUD MUTY_ECOLI A:[4-225] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILNGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK--------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 77.1743% -88 - C2 -1MUY MUTY_ECOLI A:[4-225] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK--------------------------------------------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 77.0543% -85 - C2 -1KQJ MUTY_ECOLI A:[4-225] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKHSLCPLQNGCIAAANNSWALYPGKKPK--------------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 76.9643% -88 - C2 -1KG5 MUTY_ECOLI A:[4-225] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVQRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK--------------------------------------------------------------------------------------------------------------------------------------------------
20 PsiBlast_PDB 76.7543% -88 - C2 -1KG7 MUTY_ECOLI A:[4-224] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVANKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKP---------------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 76.6343% -87 - C2 -1KG4 MUTY_ECOLI A:[4-224] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVARVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKP---------------------------------------------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 76.5643% -85 - C2 -1KG6 MUTY_ECOLI A:[4-224] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVRRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKP---------------------------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 75.9443% -86 - C2 -1WEG MUTY_ECOLI A:[4-225] -------SQFSAQVLDWYDKYGRK-TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVARVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK--------------------------------------------------------------------------------------------------------------------------------------------------