@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : gbs1903: (2015-12-11 )
MFIFKRKKQVEMPLEKIPAHIGIIMDGNGRWAKKRLKPRVMGHKAGMDALQEVTIAASGLGVKVLTVYAFSTENWSRPDDEVKFIMNLPVEFFDKYVPELDKNNVRVQVIGDTHKLPKATYDAMQRACLRTKHNSGLVLNFALNYGGRSEITNAIKEIAQDVLEAKLNPDDITEDLVANHLMTNSLPYLYRDPDLIIRTSGELRLSNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRHRRFGSV

Atome Classification :

(50 SA) .........10...-.....20---.........30........40.........50........60........70........80........90..-......100.......110.......120.......130.......140.......150...-----....160.......170.-......180.......190.......200.......210.......220.......230.......240.......250
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFIFKRKKQVEMPL-EKIPAH----IGIIMDGNGRWAKKRLKPRV-MGHKAGMDALQEVTIAASGLGVKVLTVYAFSTENWSRPDDEVKFIMNLPVEFF-DKYVPELDKNNVRVQVIGDTHKLPKATYDAMQRACLRTKHNSGLVLNFALNYGGRSEITNAI-----KEIAQDVLEAKLNPDDIT-EDLVANHLMTNSLPYLYRDPDLIIRTSGELRLSNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRHRRFGSV
22 PsiBlast_CBE 96.1770% -99 - C8 -4Q9M ISPT_STRR6 B:[12-239] ---------------Q-VPAH----IGIIMDGNGRWAKKRMQPRV-FGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFY-DNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQAL-----KLISQDVLDAKINPGDIT-EELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRR-------
2 PsiBlast_PDB 96.1670% -94 - C8 -4Q9O ISPT_STRR6 A:[6-240] --------EVEVPT-Q-VPAH----IGIIMDGNGRWAKKRMQPRV-FGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFY-DNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQAL-----KLISQDVLDAKINPGDIT-EELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRH------
21 PsiBlast_CBE 96.1570% -97 - C8 -4Q9O ISPT_STRR6 B:[12-240] ---------------Q-VPAH----IGIIMDGNGRWAKKRMQPRV-FGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFY-DNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQAL-----KLISQDVLDAKINPGDIT-EELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRH------
1 PsiBlast_PDB 94.6070% -96 - C8 -4Q9M ISPT_STRR6 A:[11-240] -------------T-Q-VPAH----IGIIMDGNGRWAKKRMQPRV-FGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFY-DNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQAL-----KLISQDVLDAKINPGDIT-EELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRH------
4 PsiBlast_PDB 92.0054% -92 - C8 -4U82 ISPT_STAAN A:[19-253] -----------LDS-SNIPEH----IAIIMDGNGRWAKKRKMPRI-KGHYEGMQTIKKITRIASDIGVKYLTLYAFSTENWSRPESEVNYIMNLPVNFL-KTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSI-----KNMFDELHQQGLNSDIID-ETYINNHLMTKDYP----DPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGL
3 PsiBlast_PDB 91.2354% -94 - C8 -4H8E ISPT_STAAN A:[19-253] -----------LDS-SNIPEH----IAIIMDGNGRWAKKRKMPRI-KGHYEGMQTIKKITRIASDIGVKYLTLYAFSTENWSRPESEVNYIMNLPVNFL-KTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSI-----KNMFDELHQQGLNSDIID-ETYINNHLMTKDYP----DPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGL
5 PsiBlast_PDB 91.2054% -86 - C8 -3WYI ? A:[18-247] ----------ELDS-SNIPEH----IAIIMDGNGRWAKKRKMPRI-KGHYEGMQTIKKITRIASDIGVKYLTLYAFSTENWSRPESEVNYIMNLPVNFL-KTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSI-----KNMFDELHQQGLNSDIID-ETYINNHLMTKDYP----DPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQ------
56 PsiBlast_CBE 89.4842% -97 - C8 -2VG2 DPDS_MYCTU D:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
81 HHSearch 88.7542% -86 - C8 -2VG3 DPDS_MYCTU A:[47-283] --------APRIPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPD----IPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
50 PsiBlast_CBE 88.4642% -93 - C8 -4ONC DPDS_MYCTU B:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
51 PsiBlast_CBE 88.3242% -94 - C8 -4ONC DPDS_MYCTU A:[50-280] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRR----
57 PsiBlast_CBE 88.2842% -96 - C8 -2VG2 DPDS_MYCTU C:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
54 PsiBlast_CBE 88.0342% -89 - C8 -2VG3 DPDS_MYCTU B:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
52 PsiBlast_CBE 87.9842% -97 - C8 -2VG3 DPDS_MYCTU D:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
59 PsiBlast_CBE 87.8742%-109 - C- -2VG2 DPDS_MYCTU A:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
58 PsiBlast_CBE 87.8042% -93 - C8 -2VG2 DPDS_MYCTU B:[50-283] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS-
53 PsiBlast_CBE 87.8042% -94 - C8 -2VG3 DPDS_MYCTU C:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
55 PsiBlast_CBE 87.7242% -89 - C8 -2VG3 DPDS_MYCTU A:[50-284] -----------IPA-DRLPNH----VAIVMDGNGRWATQRGLART-EGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVV-RRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEAT-----REIAREVAAGRLNPERIT-ESTIARHLQRPDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
8 PsiBlast_PDB 87.2844% -99 - C8 -1V7U UPPS_ECOLI A:[13-239] -----------------LPAHGCRHVAIIMDGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR-------
10 PsiBlast_PDB 86.9744% -96 - C8 -1X07 UPPS_ECOLI A:[10-240] --------------SEKLPAHGCRHVAIIMDGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
49 PsiBlast_CBE 86.9644% -96 - C8 -1X08 UPPS_ECOLI A:[13-240] -----------------LPAHGCRHVAIIMAGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
48 PsiBlast_CBE 86.8644% -94 - C8 -1X09 UPPS_ECOLI A:[9-239] -------------LSEKLPAHGCRHVAIIMAGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR-------
9 PsiBlast_PDB 86.7444% -94 - C8 -1X06 UPPS_ECOLI A:[12-240] ----------------KLPAHGCRHVAIIMDGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
18 PsiBlast_PDB 86.7144%-103 - C8 -3SGT UPPS_ECOL6 B:[13-240] -----------------LPAHGCRHVAIIMDGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSEN---PAQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
37 PsiBlast_CBE 85.9044%-104 - C8 -3SH0 UPPS_ECOLI B:[13-240] -----------------LPAHGCRHVAIIMDGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSS------AQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
19 PsiBlast_PDB 85.6944%-103 - C8 -3SGV UPPS_ECOLI B:[13-240] -----------------LPAHGCRHVAIIMDGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAF-----------VSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
46 PsiBlast_CBE 85.4344% -98 - C8 -1UEH UPPS_ECOLI B:[17-241] ---------------------GCRHVAIIMDGNGRWAKKQGKIRA-FGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWAL-DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGV-----RQLAEKVQQGNLQPDQID-EEMLNQHVCMHELAPV----DLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRER-----