@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00100: (2016-06-01 )
MNIKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIMIEASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYTPDDYVYEISQDNSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFVEKMNAKAKELGLTDYKFVNATGLENKDLHGHQPEGTSVNEESEVSAKDMAVLADHLITDYPEILETSSIAKTKFREGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAERNGMRVITVVLNAKGNLHTGRFDETKKMFDYAFDNFSMKEIYAEGDQVKGHKTISVDKGKEKEVGIVTNKAFSLPVKNGEEKNYKAKVTLNKDNLTAPVKKGTKVGKLTAEYTGDEKDYGFLNSDLAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF

Atome Classification :

(29 SA) .........10........20........30........40........50........60........70........80........90..--......----100.--.--.....110.......120.......130.......140.......150.......160.......170....---...180.......190.......200.......210.......220.......230.......240.......250.......260.......270..-.....280.....--..290---........300----.......310........320-....--...330......--.340.......350-.......360.-......370...---....380.......390.---...-----...400.......410.......420.......430.......440.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNIKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIMIEASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYT--PDDYVY----EISQ--D--NSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFVEKMNAKAKELGLTDYKFVNATGLEN---KDLHGHQPEGTSVNEESEVSAKDMAVLADHLITDYPEILETSSIAKTKFREGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAE-RNGMRVITVVLNA--KGNL----HTGRFDETKKM----FDYAFDNF-SMKEIYAEGDQV-KGHK--TISVDKGKEKEV--GIVTNKAFSLPVKN-GEEKNYKAKVT-LNKDNLTAPVKK---GTKVGKLTAEYTGDEKDY---GFL-----NSDLAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF
61 HHSearch 91.2138% -60 - C4 -1XP4 ? A:[10-378] -----------------------------------FTIAAKHAIAVEANTGKILYEKDATQPVEIASITKLITVYLVYEALENGSITLSTPVD--ISDYPY----QLTT--N--SEASNIPME-ARNYTVEELLEATLVSSANSAAIALAEKIAGSEKDFVDMMRAKLLEWGIQDATVVNTTGLNN---ETLGDNIYPGSKKDEENKLSAYDVAIVARNLIKKYPQVLEITKKPSSTFAG-----MTITSTNYMLEGMPAYRG--GFDGLKTGTTDKAGESFVGTTV-EKGMRVITVVLNA--DHQDNN--PYARFTATSSL----MDYISSTF-TLRKIVQQGDA----YQDSKAPVQDGKEDTV--IAVAPEDIYLIERVGNQS-SQSVQFTPD-SKAIPAPLEA---GTVVGHLTYED-K--------DLIGQGYITTERPSFEMVADKKIE-------------------------------
58 HHSearch 87.5533% -65 - C4 -4K91 ? A:[6-344] -------------------------------VPAPPQLAAKSYVLMDGESGQVLVENNGDQRLPPASLTKLMTAYIATKEIEAGRIGENDLVT--VSEHAW----R--------TGGSRMFIKVGSQVSVSDLLHGIIIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLPN---P--DH------------YSSARDMAVLARAIIYGEPSHYAIYAQKEFLWNN-----IKQPNRNLLLW----RDK--TVDGLKTGHTDEAGYCLVASAV-RDGQRMIAVVFGT--NS------EQARAAETQKL----LTYGFRFF-ESRNFYKKGTE----LT--KGLVWKGSEHEV--KAGLAEDLTMTLPRGQMQ-KLQASMV-L-EPQLMAPIQQ---GQVIGKVEVKLDD--------KVI---------RSADLVALNAVEEG-----------------------------
59 HHSearch 85.3533% -59 - C4 -3ITA DACC_ECOLI A:[5-352] -------------------------------TVEAPSVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVT--VGKDAW----ATGNPAL--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDA---P--G------------QFSTARDMALLGKALIHDVPEEYAIHKEKEFTFNK-----IRQPNRNRLLWS---SNL--NVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KT------DRIRFNESEKL----LTWGFRFF-ETVTPIKPDAT----FV--TQRVWFGDKSEV--NLGAGEAGSVTIPRGQLK-NLKASYT-LTEPQLTAPLKK---GQVVGTIDFQLNG--------KSI---------EQRPLIVMENVEEGG----------------------------
1 PsiBlast_PDB 85.2237% -50 - C4 -1XP4 ? A:[12-378] -------------------------------------IAAKHAIAVEANTGKILYEKDATQPVEIASITKLITVYLVYEALENGSITLSTPVD--ISDYPY----QLTT--N--SEASNIPMEAR-NYTVEELLEATLVSSANSAAIALAEKIAGSEKDFVDMMRAKLLEWGIQDATVVNTTGLNN---ETLGDNIYPGSKKDEENKLSAYDVAIVARNLIKKYPQVLEITKKPSSTFAGMT-----ITSTNYMLEGMPA--YRGGFDGLKTGTTDKAGESFVGTTV-EKGMRVITVVLNADHQDNN----PYARFTATSSL----MDYISSTF-TLRKIVQQGDAY-QDSK--A-PVQDGKEDTV--IAVAPEDIYLIERV-GNQSSQSVQFT-PDSKAIPAPLEA---GTVVGHLTYE----DKDLIGQGYI-----TTERPSFEMVADKKIE-------------------------------
21 PsiBlast_CBE 81.4433% -64 - C4 -4K91 ? B:[9-321] ----------------------------------PPQLAAKSYVLMDGESGQVLVENNGDQRLPPASLTKLMTAYIATKEIEAGRIGENDLVT--VSEHAW----RTGG--------SRMFIKVGSQVSVSDLLHGIIIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLPN---PDHYS--------------SARDMAVLARAIIYGEP-----SHYAIYAQKEFLWNNIKQPNRNLLL------WRDKTVDGLKTGHTDEAGYCLVASAV-RDGQRMIAVVFGT----NS----EQARAAETQKL----LTYGFRFF-ESRNFYKKGTELTKG------LVWKGSEHEVKAGLAEDLTMTLP--R-GQMQKLQASMV-L-EPQLMAPIQQ---GQVIGKV---------------------------------------------------------------------
3 PsiBlast_PDB 81.4132% -55 - C4 -3IT9 DACC_ECOLI A:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
77 Fugue 80.9929% -71 - C4 -1HD8 - DACA_ECOLI A:[3-356] -------------------------LNIKTMIPGVPQIDAESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVT--IG-----------------------NLKPGMQVPVSQLIRDINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVHGLDA---DGQY--------------SSARDMALIGQALIRDVPNEYSIYKEKEFTF----NGIRQLNRNGLLW------DNSLNVDGIKTGHTDKAGYNLVASAT-EGQMRLISAVMGG--RTF------KGREAESKKL----LTWGFRFF-ETVNPLKVGKEF----A--SEPVWFGDSDRA--SLGVDKDVYLTIPR-GRMKDLKASYV-LNSSELHAPLQK---NQVVGTINFQLDG-----------------KTIEQRPLVVLQEIPEGN----------------------------
28 PsiBlast_CBE 80.9132% -57 - C4 -3IT9 DACC_ECOLI C:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QL------GKSIEQRPLIVMENVEEG-----------------------------
2 PsiBlast_PDB 80.0733% -63 - C4 -4K91 ? A:[9-321] ----------------------------------PPQLAAKSYVLMDGESGQVLVENNGDQRLPPASLTKLMTAYIATKEIEAGRIGENDLVT--VSEHAW----RTGG--------SRMFIKVGSQVSVSDLLHGIIIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLPN---PDHYS--------------SARDMAVLARAIIYGEP-----SHYAIYAQKEFLWNNIKQPNRNLLL------WRDKTVDGLKTGHTDEAGYCLVASAV-RDGQRMIAVVFGT----NS----EQARAAETQKL----LTYGFRFF-ESRNFYKKGTELTKG------LVWKGSEHEVKAGLAEDLTMTLP--R-GQMQKLQASMV-L-EPQLMAPIQQ---GQVIGKV---------------------------------------------------------------------
4 PsiBlast_PDB 79.7232% -55 - C4 -3ITA DACC_ECOLI A:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
25 PsiBlast_CBE 79.2332% -59 - C4 -3ITA DACC_ECOLI D:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDA-------------------------PGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
22 PsiBlast_CBE 79.2232% -54 - C4 -3ITB DACC_ECOLI D:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
57 HHSearch 79.1229% -63 - C4 -3MZF DACA_ECOLI A:[10-357] --------------------------------PGVPQIDAESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVT--IGNDAW----ATGN--PVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVHGLDA---D--G------------QYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNG-----IRQLNRNGLLWD---NSL--NVDGIKTGHTDKAGYNLVASAT-EGQMRLISAVMGG--RT------FKGREAESKKL----LTWGFRFF-ETVNPLKVGKE----FA--SEPVWFGDSDRA--SLGVDKDVYLTIPRGRMK-DLKASYV-LNSSELHAPLQK---NQVVGTINFQLDG--------KTI---------EQRPLVVLQEIPEGNF---------------------------
29 PsiBlast_CBE 78.4332% -56 - C4 -3IT9 DACC_ECOLI B:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
24 PsiBlast_CBE 78.4332% -51 - C4 -3ITB DACC_ECOLI B:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
23 PsiBlast_CBE 78.3932% -54 * C4 *3ITB DACC_ECOLI C:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
26 PsiBlast_CBE 78.3332% -53 - C4 -3ITA DACC_ECOLI B:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
5 PsiBlast_PDB 78.2532% -55 - C4 -3ITB DACC_ECOLI A:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN--------IEQRPLIVMENVEEG-----------------------------
60 HHSearch 78.1630% -59 - C4 -3A3J DACA_HAEIN A:[3-344] ---------------------------------TPPQITAQTYVLMDYNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVT--IGESAW----GR-N--F--PDSSKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETMNKYVQQFGLKNTNFTTPHGLDD---P--NQ------------YSSARDMAIIGAHIIRDLPEEYKIYSEKDFTFNK-----IKQPNRNGLLWD---KTI--NVDGMKTGHTSQAGYNLVASATTSNNMRLISVVMGV--PT------YKGREVESKKL----LQWGFANF-ETFKTLEAGKE----IS--EQRVYYGDKNSV--KLGAFMDHFITIPKGKQS-EVKARYE-LADKNLQAPLAK---GQVIGKVVYALDG--------KDI---------ASANLQVMNDVGE------------------------------
27 PsiBlast_CBE 77.9532% -53 - C4 -3IT9 DACC_ECOLI D:[11-351] -------------------------------------VDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWAT----GNPA--L--RGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTF-----------QTVHGLDAPG------QFSTARDMALLGKALIHDVPE-----EYAIHKEKEFTFNKIRQPNRNRLLWS-----SNLNVDGMKTGTTAGAGYNLVASAT-QGDMRLISVVLGA--KTDR----I--RFNESEKL----LTWGFRFFETVTPIKPDATFV-------TQRVWFGDKSEV--NLGAGEAGSVTIPR-GQLKNLKASYT-LTEPQLTAPLKK---GQVVGTI---------DF---QLN-----GKSIEQRPLIVMENVEEG-----------------------------
13 PsiBlast_PDB 74.6731% -63 - C4 -3BEB DACA_ECOLI A:[15-338] -------------------------------------IDAESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVT--IGNDAWATGNPVFK--G--SSL--MFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNS-----------YVNALGLKNTHFQTVHGLDADG------QYSSARDMALIGQALIRDVP---NEYSIYKEK--EFTFNGIRQLNRN----GLLWD-NSLNVDGIKTGHTDKAGYNLVASAT-EGQMRLISAVMG----GRT----FKGREAESKKL----LTWGFRFF-ETVNPLKVGKEF-ASE-----PVWFGDSDRA--SLGVDKDVYLTIPR-GRMKDLKASYV-LNSSELHAPLQK---NQVVGTINFQLDG---------------------------------------------------------------
14 PsiBlast_PDB 72.4631% -63 - C4 -3BEC DACA_ECOLI A:[15-338] -------------------------------------IDAESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVT--IGNDAWATGNPVFK--G--SSL--MFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNS-----------YVNALGLKNTHFQTVHGLDADG------QYSSARDMALIGQALIRDVP---NEYSIYKEK--EFTFNGIRQLNRN----GLLWD-NSLNVDGIKTGHTDKAGYNLVASAT-EGQMRLISAVMG----GRT----FKGREAESKKL----LTWGFRFF-ETVNPLKVGKEF-ASE-----PVWFGDSDRA--SLGVDKDVYLTIPR-GRMKDLKASYV-LNSSELHAPLQK---NQVVGTINFQLDG---------------------------------------------------------------
64 HHSearch 69.9432% -58 - C4 -1TVF ? A:[37-331] -----------------------------------------SAVNVS-QTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVT--MTNKEY----IMST--L--PELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPTGAEN---SRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTH-----AVTYYTFNFSLEGAKMSLP--GTDGLKTGSSDTANYNHTITTK-RGKFRINQVIMGA--GDYKNLGGEKQRNMMGNAL----MERSFDQY-KYVKILSKGEQ----R-------ING----K--KYYVENDLYDVLPS--------------------------------------------------------------------------------------------------------
63 HHSearch 69.7830% -48 - C4 -3HUN ? A:[74-405] ------------------------------------------AVNVS-QTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVT--MTNKEY----IMST--L--PELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPTGAEN---SRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDFTKQLAPTTH-----AVTYYTFNFSLEGAKMSLP--GTDGLKTGSSDTANYNHTITTK-RGKFRINQVIMGA--GDYKNLGGEKQRNMMGNAL----MERSFDQY-KYVKILSKGEQ----R-------INGK------KYYVENDLYDVLPSDFSKKDYKLVVE---DGKVHADYPREFINKDYGPPTVEVHQ---------------------------------------------------------------
9 PsiBlast_PDB 63.8533% -44 - C4 -1TVF ? A:[42-312] -----------------------------------------------SQTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVT--MTNKEY----IMST--L--PELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPTGAEN---SRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDF-----TKQLAPTTHAVTYYTFNFSLEG--AKMSLPGTDGLKTGSSDTANYNHTITTK-RGKFRINQVIMGA--GDYK----NLGGEKQRNMMGNALMERSFDQY-KYVKILSKGEQ--------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 61.8233% -39 - C4 -3HUN ? A:[78-348] -----------------------------------------------SQTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVT--MTNKEY----IMST--L--PELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPTGAEN---SRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKILDF-----TKQLAPTTHAVTYYTFNFSLEG--AKMSLPGTDGLKTGSSDTANYNHTITTK-RGKFRINQVIMGA--GDYK----NLGGEKQRNMMGNALMERSFDQY-KYVKILSKGEQ--------------------------------------------------------------------------------------------------------------------------------------------