@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00530: (2016-06-02 )
MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGLYGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRTKGSAGGHNGIKSLIQHLGTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVDKSVKACEASLSKPFLEVMNEFNAKV

Atome Classification :

(32 SA) -.........10........20........30......-.-.-40.-....-....50........60........70........80........90........100.......110.......120.-.......130.......140.......150.......160.......170.-..-.-...180......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIEL-N-Q-N-K-FNGL-YGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRTKGSAGGHNGIKSLIQHL-G-TSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVDKSVKACEASL-SK-P-FLEVMNEFNAKV
21 PsiBlast_CBE 98.3052%-106 - C6 -4YLY PTH_STAAU B:[1-189] -MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSL-D-K-Q-K-FKGA-YTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKML-G-TDQFKRIRIGVGRP-NGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETS-R-FDHVMNEFNGEV
52 HHSearch 97.8953%-112 - C6 -4YLY PTH_STAAU A:[1-188] -MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSL-D-K-Q-K-FKGA-YTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKML-G-TDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFV-ETSR-FDHVMNEFNGE-
1 PsiBlast_PDB 97.3952%-111 - C6 -4YLY PTH_STAAU A:[1-189] -MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSL-D-K-Q-K-FKGA-YTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKML-G-TDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFVETS-R-FDHVMNEFNGEV
2 PsiBlast_PDB 95.5648%-105 - C6 -4QT4 - PTH_STRPZ A:[4-189] ---MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTF-T-D-D-KNFKAQ-IGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHI-G-TQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYL-QEND-FEKTMQKFNG--
55 HHSearch 95.0548%-110 - C6 -4QT4 - PTH_STRPZ A:[2-189] -VKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTF-T-DDK-N-FKAQ-IGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHI-G-TQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYL-QEND-FEKTMQKFNG--
42 Fugue 94.1448%-107 - C6 -4QT4 - PTH_STRPZ A:[1-189] MVKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTF-T-D-D-KNFKAQ-IGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHI-G-TQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYL-QE-NDFEKTMQKFNG--
54 HHSearch 92.1039%-100 - C6 -4LWR ? A:[7-193] -ISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITL-K-NDP-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G--PNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINAY-
25 PsiBlast_CBE 92.0539%-100 - C6 -4OLJ ? A:[9-192] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLQDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
3 PsiBlast_PDB 91.8145%-114 - C6 -1RYN - CRS2_MAIZE A:[6-189] ---LIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITM-N-T-N-Q-FKSL-LGTGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKK----RHNGLQNVIEHLDG-RREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLV-LK-G-FSGSTERFN---
23 PsiBlast_CBE 91.6239% -99 - C6 -4JX9 ? A:[6-189] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
15 PsiBlast_PDB 91.6139% -99 - C6 -4LWR ? A:[9-192] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
57 HHSearch 91.5042%-110 - C6 -1RYB - CRS2_MAIZE A:[3-190] -PWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITM-N-T-I-Q-SKSL-LGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHL-DGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLV-LK-G------ERFNLV-
14 PsiBlast_PDB 91.4139%-100 - C6 -4LWQ ? A:[9-192] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
24 PsiBlast_CBE 91.3539%-101 - C6 -4JWK ? A:[6-189] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
16 PsiBlast_PDB 91.3039%-100 - C6 -3WH4 ? A:[9-192] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
22 PsiBlast_CBE 90.9239%-103 - C6 -4JY7 ? A:[6-189] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
19 PsiBlast_PDB 90.7139%-101 - C6 -4HOY ? A:[6-189] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
5 PsiBlast_PDB 90.2943%-109 - C6 -1RYB - CRS2_MAIZE A:[5-188] ---LIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITM-N-T-I-Q-SKSL-LGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHLDG-RREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLV-LK-G------ERFN---
17 PsiBlast_PDB 90.2239%-102 - C6 -4FOP ? A:[6-189] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
18 PsiBlast_PDB 90.0939%-101 - C6 -4FOT ? A:[6-189] ---LIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKN-D-P-K-FHGI-SGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHI-G-PN-FHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLV-QG-Q-VPQAMNQINA--
39 PsiBlast_CBE 88.2734% -96 - C6 -4DHW PTH_PSEAE A:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
32 PsiBlast_CBE 87.9034% -94 - C6 -4FNO PTH_PSEAE B:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
60 HHSearch 87.6436%-104 - C6 -3NEA PTH_FRATT A:[23-207] -IKMIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSF-SSN-P-K-LNCN-LAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHL-G-TNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDII-NY-K-LEPVMQKL----
38 PsiBlast_CBE 87.3834% -97 - C6 -4DHW PTH_PSEAE B:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
29 PsiBlast_CBE 87.1434% -95 - C6 -4QD3 PTH_PSEAE A:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
36 PsiBlast_CBE 86.8834% -94 - C6 -4DJJ PTH_PSEAE B:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
26 PsiBlast_CBE 86.6739% -94 - C6 -3KK0 PTH_MYCS2 A:[5-190] --LLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAF-K-V-H-K-KSGAEVVTGRLAGTTVVLAKPRISMNESGRQVGPLAKFYSVPPQQIVVIHDELDIDFGRIRLKLGGGEGGHNGLRSVASAL-G-TKNFHRVRIGVGRPPGRKDPAAFVLENFTSAERAEVPTIVEQAADATELLI-AQ-G-LEPAQNTVHA--
35 PsiBlast_CBE 86.2534% -96 - C6 -4ERX PTH_PSEAE A:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
30 PsiBlast_CBE 86.2534% -92 - C6 -4QBK PTH_PSEAE A:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
34 PsiBlast_CBE 85.3534% -93 - C6 -4ERX PTH_PSEAE B:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
37 PsiBlast_CBE 85.1634% -96 - C6 -4DJJ PTH_PSEAE A:[6-192] ---LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVA-D-R-K-YFGL-VGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL-GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AG-D-WTRAMQKLHSQ-
28 PsiBlast_CBE 84.3640% -98 - C6 -3NEA PTH_FRATT A:[25-189] ---MIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSF-S-S-NPK-LNCN-LAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHL-G-TNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGI-------------------------