@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00570: (2016-06-02 )
MDDSIGVKRHWIWQGAFVLILAGVITKILSAVYRVPFQNIVGDVGFYIYQQVYPFLGIAVMLSTSGFPVIISKLMNDYSEKNHHTILKISALFLSLIGILLFLCLYLGAVPIALFMGDSHLAVLIQVAAYAFLLFPFVALLRGGFQGRHEMLPSALSQMTEQFLRVAVLLGLSFWLVKKGASLYTAGAAAASGSLAGSLVALIILGFFWFKTKRDNQTDRQNENVITTKELTKKLLLYSVTICVSSLLLLFIQLVDALNLYALLSGGEASEEAKCLKGIYDRGQPLLQLGSVFAVSIATSLVPYISMAVKNKELKIMKEKITSSLKLCLVLGTGASAGLICILKPVNIMLFQNGEGTGALQVFSCSILFASLAVTAAAVLQGAGYTVFPAIAVGAGVAVKWVLNTLLVPRYGIEGASLATAASFAAVAGLNLYQLRQKEWLDKLRGVLIPIIGSALLMSAVLLAYTRLWTFLFPATGRGAAVIESLSAVAIGGAVFIYCMMRLGIFTDEELNSVPFGSKLSKFMRRREQNGG

Atome Classification :

(20 SA) ----------------------------------------------------------------------------------.....---....10.----.-......20.--------------..-----.....30..--.----...-..40---------------...-...-..--------50...------.----..---.--.60.---.--..--.-------------..------------------.70--------..--.....------.80..----.....----.---------90..----------....-..------.100.---.----.-----....110....-..-.--.-----120--.--------------........130.------......140...------....150....----------...160.......170--------........----.180.......190..-----..-------------...200---.--.--.....--.---.210......----..220..---.....230.-----------------...--...----240--.........-250....---.---..260-.....--..270.-------------...---...280-----.........290--------.-------......300--.-------......-------310..-----.....-----------.320.----.-----.....330-.....---------------------------....340.......350.--------.--.----.-----....-360---....-..-.370.......------------380.-.-------.....------------------390-.....-..-.-.400-......-------.-------410.......----..420.......430---------......--...440...--.--...450---.-......460.-------......470.......480.-..---..----...490---..---------.-.....500..--.-......510...--....520.-......530-----------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----------------------------------------------------------------------------------MDDSI---GVKRHWI----W-QGAFVLILA--------------GV-----ITKILSAVY--R----VPF-QNIV---------------GDV-GFY-IY--------QQVYP------F----LG---I--AVML---S--TS--G-------------FP------------------VII--------SK--LMNDY------SEKNH----HTILK----I---------S-AL----------FLSL-IG------ILLFL---C----L-----YLGAV-PIALF-MG-D--S-----H----L--------------AVLIQVAAYAFL------LFPFVALLRGGF------QGRHEMLPSAL----------SQMTEQFLRVAVLL----------GLSFWLVK----KGASLYTAGAAAASGS-----LA-------------GSLV-----A--L--IILGF--F---WFK-TKRDNQ----TDRQNEN---VITTKELTK-----------------KLL--LYS----V----TICVSSLLL-LFIQLVD---A---LNLYA-LLSGG--EASEEA-------------KCL---KGIY-------DRGQPLLQLGSV--------F-------AVSIATSLV--P-------YISMAV-------KN-KE-----LKIMK-----------EKITS----S-----LKLCLV---LGTGA---------------------------SAGLICILKPVNIMLF-Q--------N--G----E-----GTGA-LQV---FSCS-IL-FASLAVTAAAV------------LQGA-G-------YTVFP------------------A---IAVGA-GV-A-VKWV-LNTLLV-------P-------R--YGIEGAS----LATAASFAAVAGL-----------NLYQLR--QKEWLDKLR--G--VLIPII---G-SALLMSAVLL-------AYTRLWTFLFPATGRGAA-V-IE---SL----SAVAI----GG---------A-VFIYCM--MR--L-GIFTDEELNSVP--FGSKLSKF-MRRREQNGG-----------
27 Fugue 75.9321%-118 * C6 *4IWS - FDC_PSEAE A:[23-515] ----------------------------------------------------------------------------------MNRSA---LDFRHFVDHLRR-QGDLVDVHT--------------EVDANLEIGAITRRVY--ERRAPAPLFHNIR---------------DSLPGAR-VLGAPAGLRADRARA------H----SR---L--ALHFGLPE--HS--G-------------PR------------------DIV--------AM--LRAAMRAEPIAPRRLE----RGPVQ----E---------N-VW----------LGEQ-VD------LTRFP---V----P-----LLHEQ-DGGRY-FG-TYGF-----H----V--------------VQTPDGSWDSWS------VGRLMLVDRNTL------AGP-TIPTQHI----------GIIREQWRRLGKPT----------PWAMALGA----PPAALAAAGMPLPEGV-----SE-------------AGYV-----G--A--LV---------------------------GEP---VEVVRTQTN-----------------GLW--VPA----N----TE----------IVLEG---E---ISLDE-TALEG--PMGE-----------------Y---HGYS-------FPIGKPQPLFHV--------H-------ALSFRDQPI--L-------PICVAG-------TP-PE-----ENHT--------------IWG----T-----MISAQL---LDVAQ---------------------------NAGL-----PVD-MVW-C--------S--Y----E-----AATC-WAV---LSID-VQRLAALGTDAAAF------------AARV-A-------ETVFG------------------S---HA----------------GHLV-------P-------K--LILVGND----I-----------------------DVTEID--QVVWALATR---------------------------------AHPLHDHFAFPQI-RDFP-M-VP---YL----DAEDKARGSGG---------R-LVINCL--YP--E-QFAGQMRAATAS--FRHAYPTA-LRRRVEERWSDYGF------
31 Fugue 74.2516%-106 - C1 -5FQE ? A:[28-607] --------------------------------------------------------------------------------TTLGASI---GSTDFHY----L-QKDYDEIKKLNLNTWNEVAWIGDEL-----NSKIVMWTN--S----SPV-NNVT---------------LSS-SDF-IN--------ENGDL------ISSNNIK---I--SWLK---E--TL--ANIGRSNPSAPLEPFP------------------DII--------HN--SGSLN------IEKN---------K----I---------A-SA----------WINIKIP------RNAKP---G----I-----YNGSI-EVTAD-EL-E--K-----S-----------------------YTFDYSFE------VLNLV-----------------QPLPSET----------NTQIEFWQHPYTIA----------RYYKICKEDLFTEKHFKYLRGNLKEYRN-----MG-------------GRGV-----I--A--TIVHE--A---WNH-QSYDSDPSMIKWRKNSYGTFEFDYSHFDK-----------------WIQ--LNIDLGIL----DPEKGFGQI-KCYSIVP---W---NNRIQ-YFNEA--TNKEEA-------------INP---TP----------GSDLWINIWTQ--------F-------LTSFMSHLE--EKGWFNITYISMDE-------RS-MDDLKACVDLIE-----------NITNN----SYEHFKISSAMD---YESGN---------------------------DYSFLDRIDDISIGLS-H--------I--N----H-----NSDD-MKN---MATH-RQ-ELGLLTTIYTCTGDYPSSFTISDPSEG-A-------FTIWY------------------S---LYQNT-NG-F-LRWS-WDGWVE-------NPLENVSYK--YWEPGDP----FLIYPAEKDSIGK-----------TFYST-----PRLEKLK--E--GIRDIN---K-AKYLMEKAPN-------LKNSIENLIYSLKRPNKG-E-NA---YG----SAVAA----S--------------------KE--D-RDLTISEANRIK----NGINNF-AREFISLTM-----------
30 Fugue 70.0715%-134 * C5 *4CGY TOP3A_HUMAN A:[22-640] ------------------------------------------------------------------------------------FSR---AAMEMAL----R-GVRKVLCVAEKN-----------DA-----AKGIADLLS--N----GRM-RRRE---------------GLS-KFNKIY--------EFDYH------L----YGQNVT--MVMT---S--VS--G-------------H-------------------LLA--------HD--FQMQF------RKWQS----CNPLV----LFEAEIEKYCP-EN----------FVDI-KK------TLERE---T----R-----QCQAL-VIWTD-CD-R--E-----G----E--------------NIGFEIIHVCKA------VKPNLQVLRARFS-----EITPHAVRTAC----------ENLTEPDQRVSDAV----------DVRQELDL----RIGAAFTRFQTLRLQRIFPEVLA-------------EQLISYGSCQ--F--PTLGF--V---VER-FKAIQA----FVPEIFH---RIKVTHDHK-----------------DGI--VEF----NWKRHRLFNHTACL-VLYQLCV---EDPMATVVE-VRSKP--KSKWRP-------------QALDT-VELE-------KLASRKLRINAK--------E-------TMRIAEKLYTQG-------YISYPRTETNIFPRD-LN-----LTVLV-----------EQQTPDPRWG-----AFAQSI---LERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLAC-C--------S--Q----D-----AQGQ-ETT---VEID-IA-QERFVAHGLMI------------LARN-Y-------LDVYP------------------Y---DHWSD-KI-L-PVYE-QGSHFQ-------PST-----V--EMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIK--ARMYVGLTP--DKRFLPGHL---G-MGLVEGYDSM-------GYEM------SKPDLRAE-L-EA---DL----KLICD----GK---------KDKFVVLR--QQ--V-QKYKQVFIEAVA--KAKKLDEA-LAQYFGNGT-----------
18 HHSearch 67.1012%-117 - C4 -3W4T ? A:[13-447] --------------------------------------------------------------------------------------R---GDPKKAI----V-RLSIAMMIG--------------MS-----VQTLYNLAD--G----IW--VSGL---------------GPE-SLA-AV--------GLFFP------V----FM---G--IIALA--AGLGV--G-------------TS------------------SAI--------AR--RIGAR------DKEGA----DNVAV----H---------S-LI----------LSLI-LG------VTITI---T----M-----LPAID-SLFRS-MGAK--GEAVE-L----A--------------IEYARVLLAGAF------IIVFNNVGNGIL------RGEGDANRAML----------AMVLGSGLNIVLDP----------IFIYTL-----------GFGVVGAAYAT-----LL-------------SMVV-----T--S--LFIAYW-L---FVK-RDTYVD----IT--LRD---FSPSREILK-----------------DIL--RVG----L----PSSLSQLSM-SIAMFFL---N---SVAIT-AGG-----------------------ENG---VAVF-------TSAWRITMLGIV--------P-------ILGMAAATT--S-------VTGAAY-------GE-RN-----VEKLE-----------TAYLY----A-----IKIAFM---IELAV---------------------------VAFIMLFAPQVAYLFT-Y-----------------VIKGDLISA-LRT---LPVF-LV-LTPFGMMTSAM------------FQGI-G-------EGEKS------------------L---ILTIFRTL-V-MQVG-FAYIFV-------HYT-----T--LGLRGVW----IGIVIGNMVAAIV-----------GFLWGR--MR-------------------------------------------------------------------------------------------------------------------------------------------------------
26 Fugue 64.5619%-109 - C4 -4S3Q MALQ_ECOLI A:[2-691] ------------------------------------------------------------------------------ESKRLDNAALAAGISPNYI----NAHGKPQSISA--------------ET-----KRRLLDAMH--Q----TPV-PNVMVYTSGKKMPMVVEGSGEY-SWL-LTTEEGT---QYKGH------V----TG---G--KAFN---L--PT--K-------------LPEGYHTLTLTQDDQRAHCRVIVAPKRCYEPQA--LLNK--------QKLW----GACVQ----L---------Y-TLRSEKNWGIGDFGDL-KA------MLVDV---AKRGGS-----FIGLN-PIHAL-YP-A--N-----P----ESASPYSPSSRRWLNVIYIDVNAVEDF------HLSEEAQAWWQL------PTTQQTLQQARDADWVDYSTVTALKMTALRMAWKGFAQRDDEQMAAFRQFVAE----QGDSLFWQAAFDALHA-----QQ-------------VKED-----E--M--R-WGW--P---AWP-EMYQNV----DSPEVRQ---FCEEHRDDV-----------------DFY--LWL----Q----WLAYSQFAA-CWEISQGYEMP---IGLYR-DLAVGVAEGGAET-------------WCD---RELYCLKASVGAPPDILGPLGQN--------WGLPPMDPHIITARAYE--P-------FIELLR-------ANMQN-----CGALRI----------DHVMS----M-----LRLWWIP--YGETA---------------------------DQGAYVHYPVDDLLSI-L--------A--L----E-----SKRHRCMV---IGED-LG-TVPVEIVGKLR------------SSGVYS-------YKVLYFENDHEKTFRAPKAYPEQS---MAVAA-TH-D-LP-T-LRGYWE-------C-------G--DLTLGKT----LGLYPDEVVLRGLY----------QDRELA--KQGLLDALHKYG--CLPKRA---GHKASLMSMTPT-------LNRGLQRYIADSNSALLG-LQPE---DWLDMAEPVNI----PG---------T-SYQYKN--WRRKL-SATLESMFADDG--VNKLLKDL-DRRRRSAH------------
32 Fugue 62.9016%-117 * C3 *1IKP TOXA_PSEAE A:[2-606] -----------------------------------------------------------------------------------EEAF---DLWNEC-------AKACVLDLK--------------DG-----VRSSRMSVD--P----AIA-DT-----------------NGQ-GVL-HY--------SMVLEGGNDALK----LA---IDNALSI---T--SD--G-------------LT------------------IRL--------EG--GVEPN------KPVRY----SYTRQARGSW---------S-LN----------WLVP-IGHEKPSNIKVFI---H----ELNAGNQLSHMSPIYTIEMG-D--E-----L----L--------------AKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQKRWSEWASGKV----------LCLLDQLDGVYNYLAQQRC-----NLDDTWEG----KIYRVLAGNPAKHDLD-----IKPTVISHRLHFPEGGSLA-----A--L--TAHQACHL---PLE-TFTRHR----QPRGAEQ---LEQCGYPVQ-----------------RLV--ALY----L----AARLS-------WNQVD---Q---VIRNA-LASPG--SGGDLG-------------EAI---REQP-------EQARLALTLAAA--------E-------SERFVRQGT--G-------NDEAGA-------AN-AD-----VVSLT-----------CPVAA----G-----E--CA-----GPAD---------------------------SGDALLERNYPTGAEF-L--------G--D----G-----GDVS-FST---RGTQ-NW-TVERLLQAHRQ------------LEER-G-------YVFVG------------------Y---HGTFL-EA-A-QSIV-FGGVRA-------R-------S--QDLDAIW----RGFYIAGDPALAY-----------GYAQDQ--EPDARGRIRN-G--ALLRVY---V-PRSSLPGFYR---------TSLTLAAPEAAGEVER-L-IGHPLPL----RLDAI----TGPEEEGGRLET-ILGWPL--AE--R-TVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGK
34 Fugue 60.6119%-118 - C5 -4BS9 ? A:[3-781] PTALQIKPHFHVEIIEPKQVYLLGEQGNHALTGQLYCQILPFLNGEYTREQIVEKLDGQVPEEYIDFVLSRLVEKGYLTEVAPELSL---EVAAFWS----E-LGIAPSVVA--------------EG-----LKQPVTVTTAGK----GIR-EGIV---------------ANL-AAA-LE--------EA---------------G---I--QVSD---P--TA--Q-------------LQ------------------VVL--------TDDYLQPEL------AAINK----EALER----Q---------QPWL----------LVKP-VG------SILWL----------------G---PLFVP-GE-T--G-----C----W--------------HCLAQRLQGNRE------VEASVLQQKRAL------QERPTARATLP----------STLQTGLQWAATEI----------AK--WMVK----RHLNAIAPGTARFP-T-----LA-------------GKIF-----T--FNQTTLEL--K---AHPLSRRPQC----PTCGDRE---TLQRRGFEPLKLESRPKHPEQTVQKYQHL--IGP----I----TGVVTELVRSRASGLCE---A---IERYSGIFQGD--EPRKRATLAELGDLAIHPEQCLHFSDRQY-------DNRESSNERATVTHDWIPQRF-------DASKAHDWT--P-------VWSLTEQ------TH-KY-----LPTALCYYRYPFPPEHRFCRS----D-----SNGNAAGNTLEEAI---------------------------LQGFMELVERDSVCLWWY--------N--R----V-----SRPA-VDL---SSFDEPY-FLQLQQFYQTQ------------NRDL-W-------VLDLT------------------ADLGIPAFV-GV-S-NRKA-GSSERI---------------I--LGFGAHL----DPTVAILRALTEV-----------NQIGLELDATDWLVNAT--L--AASPYLVADA-SQPLKTAKDYPRRWSDDIYTDVMTCVEIAKQAGLETL-VL---DQ----TRPDI----GL---------N-VVKVIVPGMR--FWSRFGSGRLYDVP--VKLGWREQ-PLAEAQMNPTPMPF------
3 PsiBlast_PDB 59.1319% -94 - C4 -3VVN ? A:[171-420] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LAMVL----------GSGLNIVL----DPIFIYTLGFGVVGAA-----YA--------------TLL-----S--M--VVTSL--FIAYWLF-VKRDTY----VDITLRD---FSPSREILK-----------------DIL--RVG----L----PSSLSQLSM-SIAMFF--------LNSVA-ITAGG--ENG----------------------VAVF-------TSAWRITMLGIV--------P-------ILGMAAATT--S-------VTGAAY-------GE-RN-----VEKLE-----------TAYLY----A-----IKIAFM---IEL-A---------------------------VVAFIMLFAPQVAYLF-TAQVI----K--G----D-----LISA-LRT---LPVF-LV-LTPFGMMTSAM------------FQGI-GEGEKSLILTIFR------------------T---LVMQV-GF-A-YIFV-HYTTL-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 HHSearch 59.0212%-109 - C4 -5C6N - ? A:[14-441] -------------------------------------------------------------------------------------------AIPKLL----R-SLSIPAMIG--------------MF-----VMALYNVVN--T----IFI-SYAV---------------GIE-GVA-GV--------TIAFP------I----MM---I--MMSM---AG-ALGIG-------------GA------------------SVI--------SR--RLGER------RGEEA----NQVFG----N---------I-LT----------VILV-LS------VIGFI---S----A-----FTLLG-PALQL-FGAT--S-----VTQGYA--------------TDYLFPILLGSI------FFFFAFAANNII------RSEGNATFAMV----------TMIVPAVLNILLDV----------LFIFGL-----------NMGVLGASIAT-----VI-------------AQAS-----V--T--GLVLR--Y---FLT-GKSTLS----LH--WSD---LRMKGSVIK-----------------EVC--LVG----L----PAFVQQSSA-SLMMIAI---N---SMLLR-FGS-----------------------DFY---VGVF-------GLVQRIMMFVMM--------P-------MMGIMQAMQ--P-------IVGYNY-------GA-KQ-----YSRLR-----------ETVML----G-----FKVATI---FSIGI---------------------------FALLMLFPEALLRVFT-A--------D--REVIQA-----GVSA-MHI---LFCV-TF-LIGAQIVAGGL------------YQSL-G-------KPKQA------------------L---ILSLS-RQ-I-IFLIPLVLILP-------H-------I--FGLSGVW----WAFPIADVLSFIL-----------TVVLLY--RD-------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 58.5519% -97 - C4 -3W4T ? A:[171-420] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LAMVL----------GSGLNIVL----DPIFIYTLGFGVVGAA-----YA--------------TLL-----S--M--VVTSL--FIAYWLF-VKRDTY----VDITLRD---FSPSREILK-----------------DIL--RVG----L----PSSLSQLSM-SIAMFF--------LNSVA-ITAGG--ENG----------------------VAVF-------TSAWRITMLGIV--------P-------ILGMAAATT--S-------VTGAAY-------GE-RN-----VEKLE-----------TAYLY----A-----IKIAFM---IEL-A---------------------------VVAFIMLFAPQVAYLF-TYVI-----K--G----D-----LISA-LRT---LPVF-LV-LTPFGMMTSAM------------FQGI-GEGEKSLILTIFR------------------T---LVMQV-GF-A-YIFV-HYTTL-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
28 Fugue 58.1420%-105 - C6 -1SQ9 SKI8_YEAST A:[3-395] ------------------------------------------------------------------------------------------------------------------------------KV-----FIATANA--------------------------------GKA-HDA-DI--------FSVSA------C----NS---F--TVSC---S--GD--G-------------YL------------------KVWD-------NK--LLDNE------NPKDK----SYSHF----V---------H-KS----------GLHH-VD------VLQAIERDA----F-----ELCLV-ATTSF-SG-D--L-----L----F--------------YRITREDETKKV------IFEKLDLLDSDM------KKH--------------------------------------------SFWALK----WGAS--------NSHR-----LV-------------ATDV-----KGTT--YIWKF--H---PFA-DESNSL----TLNWSPT---LELQGTVES-----------------PMTPSQFA----T----SVDISERGL-IATGFNN-----------------------------------------------------------------GTV--------Q-------ISELSTLRP--L-------YNFESQ-------HN-NS-----NSIRS-----------VKFSP----Q-----GSLLAI---AHDSN---------------------------SFGCITLYET-------E--------F--G----E-----RIGS-LSVPGEFAHS-SW-VMSLSFND--------------------------------------------------------------------------------------------------SGET----LCSAGWDG-------------------KLR--FWDVKTKER--I--TTLNMH---C-DDIEIEEDIL-------AVDEHG----------------D---SL----AEPGV----FD---------V-KFLKKG--WR--S-GMGAD--LNESL--CCVCLDRS-IRWFREAG------------
7 PsiBlast_PDB 57.4319% -96 - C4 -3WBN ? A:[171-420] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LAMVL----------GSGLNIVL----DPIFIYTLGFGVVGAA-----YA--------------TLL-----S--M--VVTSL--FIAYWLF-VKRDTY----VDITLRD---FSPSREILK-----------------DIL--RVG----L----PSSLSQLSM-SIAMFF--------LNSVA-ITAGG--ENG----------------------VAVF-------TSAWRITMLGIV--------P-------ILGMAAATT--S-------VTGAAY-------GE-RN-----VEKLE-----------TAYLY----A-----IKIAFM---IEL-A---------------------------VVAFIMLFAPQVAYLF-TYSESAQVIK--G----D-----LISA-LRT---LPVF-LV-LTPFGMMTSAM------------FQGI-GEGEKSLILTIFR------------------T---LVMQV-GF-A-YIFV-HYTTL-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------