@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00680: (2016-06-02 )
MMKHDIEKVLISEEEIQKKVKELGAELTSEYQDTFPLAIGVLKGALPFMADLIKHIDTYLEMDFMDVSSYGNSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDSGLTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADFVGFEVPDAFVVGYGLDYAERYRNLPYIGVLKPAVYES

Atome Classification :

(94 SA) .........10........20........30..-------...------..------.40........50.....---..--------.---------60-----------.------------........70........80......-..90........100.......110.......120.......130.....-..140.......150.......160.......170.......180
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MMKHDIEKVLISEEEIQKKVKELGAELTSEYQD-------TFP------LA------IGVLKGALPFMADLIKHI---DT--------Y---------L------------E------------MDFMDVSSYGNSTVSSGEVKIIKDLD-TSVEGRDILIIEDIIDSGLTLSYLVELFRYRKAKSIKIVTLLDKPSGRKA-DIKADFVGFEVPDAFVVGYGLDYAERYRNLPYIGVLKPAVYES
3 PsiBlast_PDB 91.7878%-155 - C3 -3KB8 ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
23 PsiBlast_CBE 91.5578%-153 - C3 -3KB8 ? B:[25-204] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYSN
1 PsiBlast_PDB 91.3878%-152 - C3 -3H83 ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
29 PsiBlast_CBE 91.0778%-145 - C3 -3H83 ? B:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
114 HHSearch 90.7379%-149 - C3 -3HVU ? A:[26-203] -MNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
2 PsiBlast_PDB 90.4578%-149 - C3 -3HVU ? A:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
21 PsiBlast_CBE 90.2078%-144 - C3 -3KB8 ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
26 PsiBlast_CBE 90.1578%-147 - C3 -3HVU ? B:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
27 PsiBlast_CBE 89.4878%-146 - C3 -3H83 ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
24 PsiBlast_CBE 89.2478%-147 - C3 -3HVU ? D:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
25 PsiBlast_CBE 88.9778%-145 - C3 -3HVU ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
22 PsiBlast_CBE 88.5478%-144 - C3 -3KB8 ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
28 PsiBlast_CBE 87.9078%-143 - C3 -3H83 ? C:[25-203] MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TVP------LA------IGVLKGAMPFMADLLKRT---DT--------Y---------L------------E------------MDFMAVSSYGHSTVSTGEVKILKDLD-TSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKV-DLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS-
6 PsiBlast_PDB 85.2760%-143 - C3 -1R3U ? A:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KDL------VL------IGVLKGAIMFMSGLSRAI---DL--------P---------L------------S------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREA-DVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY--
124 HHSearch 84.6461%-143 - C3 -1YFZ ? A:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KDL------VL------IGVLKGAIMFMSGLSRAI---DL--------P---------L------------S------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREA-DVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY--
7 PsiBlast_PDB 84.3960%-143 - C3 -1YFZ ? A:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KDL------VL------IGVLKGAIMFMSGLSRAI---DL--------P---------L------------S------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREA-DVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY--
117 HHSearch 84.3260%-143 - C3 -2GEB ? A:[9-184] --MEDIEEILITEEQLKAKVKELGEMITRDYEG-------KDL------VL------IGVLKGAIMFMSGLSRAI---DL--------P---------L------------S------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREA-DVKVDYCGFKIPDKFVVGYGIDYAEKYRNLPFIGVLKPELY--
8 PsiBlast_PDB 84.1060%-145 - C3 -2GEB ? A:[10-184] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KDL------VL------IGVLKGAIMFMSGLSRAI---DL--------P---------L------------S------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREA-DVKVDYCGFKIPDKFVVGYGIDYAEKYRNLPFIGVLKPELY--
30 PsiBlast_CBE 83.9260%-144 - C3 -1YFZ ? B:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KDL------VL------IGVLKGAIMFMSGLSRAI---DL--------P---------L------------S------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREA-DVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY--
31 PsiBlast_CBE 83.1960%-140 - C3 -1R3U ? B:[30-204] ---EDIEEILITEEQLKAKVKELGEMITRDYEG-------KDL------VL------IGVLKGAIMFMSGLSRAI---DL--------P---------L------------S------------IDFLAVSSYGSSTKSSGIVKIIKDHD-IDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREA-DVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY--
83 PsiBlast_CBE 82.9942%-145 - C3 -1I13 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVATALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
77 PsiBlast_CBE 82.7742%-146 - C3 -1I0L ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVNTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
79 PsiBlast_CBE 82.3642%-146 - C3 -1I14 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
81 PsiBlast_CBE 82.2642%-144 - C3 -1I0I ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVQTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
82 PsiBlast_CBE 82.0642%-143 - C3 -1I0I ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVQTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
71 PsiBlast_CBE 81.9742%-144 - C3 -1P18 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLRGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
5 PsiBlast_PDB 81.8858%-149 - C3 -4RQB ? A:[10-186] ---NDLKEVLLTEEDIQNICKELGAQLTKDYQG-------KPL------VC------VGILKGSAMFMSDLIKRI---DT--------H---------L------------S------------IDFMDVSSYHGGTESTGEVQIIKDLG-SSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKA-DIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVYSN
63 PsiBlast_CBE 81.3843%-143 - C3 -1TC2 ? B:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
84 PsiBlast_CBE 81.1142%-146 - C3 -1I13 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVATALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
80 PsiBlast_CBE 80.5542%-142 - C3 -1I14 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
69 PsiBlast_CBE 80.1743%-142 - C3 -1TC1 ? B:[8-189] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
78 PsiBlast_CBE 79.9842%-143 - C3 -1I0L ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVNTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
45 PsiBlast_CBE 79.7448%-150 - C3 -4RHY HPRT_MYCTU D:[21-201] ----DIKSVLLTAEQIQARIAELGEQIGNDYR----------ATTGQDLLL------ITVLKGAVLFVTDLARAI---PV--------P---------T------------Q------------FEFMAVSSYGS----SGVVRILKDLD-RDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHA-NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ-
68 PsiBlast_CBE 79.6143%-144 - C3 -1P19 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSY--GLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
72 PsiBlast_CBE 79.5842%-145 - C3 -1P18 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLRGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
74 PsiBlast_CBE 79.4942%-147 - C3 -1P17 ? C:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLRGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGE---SSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
46 PsiBlast_CBE 79.3948%-154 - C3 -4RHY HPRT_MYCTU C:[21-201] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE----------TTGQDLLL------ITVLKGAVLFVTDLARAI---PV--------P---------T------------Q------------FEFMAVSSY------SGVVRILKDLD-RDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHA-NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ-
64 PsiBlast_CBE 79.3643%-146 - C3 -1TC2 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLKGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYGEGLTSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
113 HHSearch 79.1549%-154 - C3 -4RHX HPRT_MYCTU A:[18-200] -YPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTG-QDL------LL------ITVLKGAVLFVTDLARAI---PV--------P---------T------------Q------------FEFMAVSSYG----SSGVVRILKDLD-RDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHA-NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY--
76 PsiBlast_CBE 78.9842%-148 - C3 -1P17 ? A:[9-190] ------EKILFTEEEIRTRIKEVAKRIADDYKGKGLRPY-VNP------LVL-----ISVLRGSFMFTADLCRAL---CD--------FNVP------V------------R------------MEFICVSSYG---TSSGQVRMLLDTR-HSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRV-PFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY--
52 PsiBlast_CBE 78.7848%-155 - C3 -4RHX HPRT_MYCTU A:[21-200] ----DIKSVLLTAEQIQARIAELGEQIGNDYRE-------LSATTGQDLLL------ITVLKGAVLFVTDLARAI---PV--------P---------T------------Q------------FEFMAVSSYGS----SGVVRILKDLD-RDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHA-NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY--
62 PsiBlast_CBE 78.7148%-154 - C3 -4RHT HPRT_MYCTU A:[21-198] ----DIKSVLLTAEQIQARIAELGEQIGNDYR-----------GQDL--LL------ITVLKGAVLFVTDLARAI---PV--------P---------T------------Q------------FEFMAVSSYG------GVVRILKDLD-RDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHA-NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPR----