@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00790: (2016-06-02 )
MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQAQFLNMAVEIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMYERLFVLAPLAEICQQVEKEATSAETDQEGVRVWKQKSGVDEFVHSES

Atome Classification :

(62 SA) .........10........20........30........40........50...--.....60........70........-80......-.-.-.90........100..-----.....110..-------.....120.......130.-......140.......150.......160.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQAQ--FLNMAVEIKTSLNPFELLELTQQIE-N-ELGRTR-E-V-RWGPRTADLDILLFNR-----ENIETEQLIV-------PHPRMYERLFVLAPLAEIC-QQVEKEATSAETDQEGVRVWKQKSGVDEFVHSES
1 PsiBlast_PDB 92.1152%-135 - C6 -3QBC ? A:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
24 PsiBlast_CBE 91.5752%-140 - C6 -3QBC ? B:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
4 PsiBlast_PDB 91.3352%-130 - C6 -4CWB ? A:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
3 PsiBlast_PDB 90.9052%-128 - C6 -4CRJ ? A:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
23 PsiBlast_CBE 90.8852%-138 - C6 -4AD6 ? B:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
82 Fugue 90.7643% -90 - C6 -1Q0N HPPK_ECOLI A:[1-158] --TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVRKA-E-RWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEI-------APELVFPDGEMLRQILHTRAFDKLNKW--
22 PsiBlast_CBE 90.1852%-129 - C6 -4CYU ? C:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
2 PsiBlast_PDB 89.9452%-137 - C6 -4AD6 ? A:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
21 PsiBlast_CBE 89.8252%-127 - C6 -4CYU ? D:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
5 PsiBlast_PDB 89.5252%-130 - C6 -4CYU ? B:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAP---TEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
72 HHSearch 88.8949%-112 - C6 -4CWB ? A:[3-144] HMIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANVVEPRSK-------------------------
29 PsiBlast_CBE 87.9647%-139 - C6 -3UDE HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGR------ERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
35 PsiBlast_CBE 87.9247%-131 - C6 -3KUE HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIA-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
38 PsiBlast_CBE 87.8147%-132 - C6 -3HSD HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--ALNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
25 PsiBlast_CBE 87.8152%-135 - C6 -4CYU ? A:[7-138] ----AYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETA----TEQPN--FLNLCVEIQTTLTVLQLLECCLKTE-E-CLHRIR-K-E-RWGPRTLDVDILLYGE-----EMIDLPKLSV-------PHPRMNERAFVLIPLNDIA-ANV-------------------------------
28 PsiBlast_CBE 87.3247%-139 - C6 -3UDV HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGR------ERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
39 PsiBlast_CBE 87.2947%-131 - C6 -3HD2 HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDAPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
53 PsiBlast_CBE 87.2747%-133 - C6 -3HT0 HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGAMLWPLFEIA-PEL-------------------------------
37 PsiBlast_CBE 87.0047%-134 - C6 -3HSD HPPK_ECOLI B:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--ALNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
31 PsiBlast_CBE 86.9447%-128 - C6 -3IP0 HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
36 PsiBlast_CBE 86.8947%-132 - C6 -3HSG HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--ALNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
10 PsiBlast_PDB 86.5847%-131 - C6 -4M5J HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR----ERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
26 PsiBlast_CBE 86.5247%-124 - C6 -4M5N HPPK_ECOLI B:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
73 HHSearch 86.4646%-115 - C6 -3IP0 HPPK_ECOLI A:[1-139] --TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-KAE-RWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PELVFPD---------------------------
15 PsiBlast_PDB 86.3147%-123 - C6 -1DY3 HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
32 PsiBlast_CBE 86.3047%-128 - C6 -1RB0 HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
12 PsiBlast_PDB 86.2147%-128 - C6 -4M5L HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
45 PsiBlast_CBE 86.1447%-125 - C6 -1F9H HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPATLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
13 PsiBlast_PDB 86.0947%-126 - C6 -4M5M HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
14 PsiBlast_PDB 86.0047%-125 - C6 -4M5N HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
11 PsiBlast_PDB 85.9147%-126 - C6 -4M5K HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
20 PsiBlast_PDB 85.8947%-132 - C6 -1RAO HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
9 PsiBlast_PDB 85.8247%-126 - C6 -4M5I HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
19 PsiBlast_PDB 85.7947%-125 - C6 -1Q0N HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
16 PsiBlast_PDB 85.7747%-125 - C6 -1EX8 HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
55 PsiBlast_CBE 85.7247%-125 - C6 -3KUH HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PAYDMKNRGFMLWPLFEIA-PEL-------------------------------
57 PsiBlast_CBE 85.6347%-124 * C6 *1TMM HPPK_ECOLI A:[2-135] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERAGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
8 PsiBlast_PDB 85.6247%-126 - C6 -4M5H HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------
7 PsiBlast_PDB 85.5547%-125 - C6 -4M5G HPPK_ECOLI A:[6-139] ---VAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD--YLNAAVALETSLAPEELLNHTQRIE-L-QQGRVR-K-AERWGPRTLDLDIMLFGN-----EVINTERLTV-------PHYDMKNRGFMLWPLFEIA-PEL-------------------------------