@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu00890: (2016-06-02 )
MLKRIVQAFFIIFGGVVGIFLIPELFVLLNIQDIPLITNAYTSAAIGAIIFFLISIWGTEYVVNWVKWIEDSLLKAPVPDLLFGSLGLVFGLIIAYLIVNVIPLDNIPYRIFSTIIPVFLAFFLGYLGFQVGFKKKDELISLFSISARMQKKKGTADEEHEVQDKKLKILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGLDILNRIQKELDIEVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVAVLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHIDVLVTSVLQTAAGRMIFAKPKLLEKAL

Atome Classification :

(20 SA) .........10........20........30........40........50......---------..60........70........80........90........100.......110----.......120.......130......----------------.140.......150.......160.......170.......180-----.------.---....--.--.--190.....----..200......-.210.---.------.....220-.-..-...---.230--.-----.-----.---.-.-----.--------.--------.---240.-------..----.-----..-----..------.250-.....-----.--------------.260----------------.---.......---.-----270---.....-..280.......290.......300.......310...---....320......-.330.......340.......350-----........360....----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLKRIVQAFFIIFGGVVGIFLIPELFVLLNIQDIPLITNAYTSAAIGAIIFFLISIW---------GTEYVVNWVKWIEDSLLKAPVPDLLFGSLGLVFGLIIAYLIVNVIPLDNIPYRIF----STIIPVFLAFFLGYLGFQVGFKKKDE----------------LISLFSISARMQKKKGTADEEHEVQDKKLKILDTSVIIDGRIA------D------I---CQTG--F--L--EGVIVIPQ----FVLEELQHIAD-SSDVL---K------RNRGRRGL-D-IL-NRI---QKE---L-----D-----I---E-V-----E--------I--------Y---E--G-------DF----E-----DI-----QE------VDSK-LVKLA-----K--------------LT------------------S---GVVVTND---F-----NLN---KVCEL-QKVAVLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQ---GVAYLDDGTMIVV-EEGRNYIGKHIDVLVTSVLQTAA------GRMIFAKPKLLEKAL----
7 HHSearch 99.9142%-112 - C3 -3IX7 - Y540_THET8 A:[3-133] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APRGGKVLDTSVLVDGRVA------E------V---AAVG--F--L--EGPLWVPH----FVLKELQHFAD-SQDPL---R------RAKGRRGL-E-TL-ERL---REA---A-----P-----------L-----E--------V--------L---E----------TT----P-----KG-----ES------VDEK-LLFLA-----R--------------DL------------------E---AALVTND---H-----ALL---QMARI-YGVKALSIQALAQALRPQL------------------------------------------------------------------------------------
1 PsiBlast_PDB 97.9044%-100 - C3 -3IX7 - Y540_THET8 A:[8-131] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KVLDTSVLVDGRVA------E------V---AAVG--F--L--EGPLWVPH----FVLKELQHFAD-SQDPL---R------RAKGRRGL-E-TL-ERL---REA---A-----P-----L---E-V-----L--------E--------T---T--P-------KG----E-----S--------------VDEK-LLFLA-----R--------------DL------------------E---AALVTND---H-----ALL---QMARI-YGVKALSIQALAQALRP--------------------------------------------------------------------------------------
6 PsiBlast_CBE 97.0544%-105 - C3 -3IX7 B:[8-131] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KVLDTSVLVDGRVA------E------V---AAVG--F--L--EGPLWVPH----FVLKELQHFAD-SQDPL---R------RAKGRRGL-E-TL-ERL---REA---A-----P-----L---E-V-----L--------E--------T---T--P-------KG----E-----S--------------VDEK-LLFLA-----R--------------DL------------------E---AALVTND---H-----ALL---QMARI-YGVKALSIQALAQALRP--------------------------------------------------------------------------------------
12 HHSearch 86.1727%-101 - C3 -3I8O Y1533_METJA A:[3-136] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AKKVCVDTCVVIDGRIT------E------L---IERG--K--LK-DATIIIPE----AVVSELEYQAN-MGREI-------------GYKGI-E-EL-RKL---IEKASEH-----N-----I---K-V-----E--------Y--------Y---G--ERPTREEIFL----A-----KS-----GE------IDAM-IRKVA-----K--------------ET------------------N---SILLTSD---W-----IQY---NLAKA-QGIEAYFLEAAEEE-----------------------------------------------------------------------------------------
27 Fugue 82.8027% -95 - C3 -3I8O Y1533_METJA A:[3-142] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AKKVCVDTCVVIDGRIT------E------L---IERG--K--LK-DATIIIPE----AVVSELEYQANMG--------------REIGYKGI-E-EL-RKL---IEK---A-----SEHN--I---K-V-----E--------Y--------Y---G--E-------RP----T-----RE-----EIFLAKSGEIDAMIRKVA-----K--------------ET------------------N---SILLTSD---W-----IQY---NLAKA-QGIEAYFLEAAEEEVELVLD-----------------------------------------------------------------------------------
2 PsiBlast_PDB 81.8832%-112 - C3 -3I8O Y1533_METJA A:[7-122] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CVDTCVVIDGRIT------E------L---IERG--K--LK-DATIIIPE----AVVSELEYQAN-MG-------------REIGYKGI-E-EL-RKLIEKASE---H-----N-----I---K-V-----E--------Y--------YGE-R--P-------TR----E-----EIFLAKSGE------IDAM-IRKVA-----K--------------ET------------------N---SILLTSDWIQY-----NLA---KA-----------------------------------------------------------------------------------------------------------
10 HHSearch 77.2417% -83 - C3 -2DOK - EST1A_HUMAN A:[7-184] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ELEIRPLFLVPDTNGFIDHL--------A------S---LARL--L--ESRKYILVVPL----IVINELDGLAK-----A---GGYARVVQEKARKSI-E-FL-EQR---FES---RDS---C-----L---R-A-----L--------TSRGNELESIAFRS--E-------DI-----------------GN------NDDL-ILSCC-----L--------------HYCKDKAKDFMPAEPIRLLRE---VVLLTDD---R-----NLR---VKALT-RNVPVRDIPAFLTWAQ---------------------------------------------------------------------------------------
29 Fugue 68.9216% -57 - C3 -2HWW - EST1A_HUMAN A:[1239-1418] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MELEIRPLFLVPDTNGFIDHLAS------L------A---RLLE--S--R--KYILVVPL----IVINELDGLAK-GAGGY---A------RVVQEKAR-K-SI-EFL---EQR---F-----ESRDSCL---R-A-----L--------T--------S---R--G-------NE----LESIAFRS-----EN------NDDL-ILSCC-----LHYCKDKAKDFMIRLLR------------------E---VVLLTDD---R-----NLR---VKALT-RNVPVRDIPAFLTWAQV--------------------------------------------------------------------------------------
24 HHSearch 68.3819% -65 - C3 -5ECD ? A:[7-129] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HLKFMLDTNICIFTIKNKP----A------S---VRER--FNLN--QGKMCISS----VTLMELIYGAE-KSQMP-----------ERNLAVI-EGFV-SRI---DVL---DYDAAAA-----T---H-T-----G--------Q--------I---R--A-------ELARQGR-----PV-----GP------FNQM-IAGHA-----R--------------SR------------------G---LIIVTNNT--R-----EFE---RV-----------------------------------------------------------------------------------------------------------
20 HHSearch 67.4817% -64 - C3 -4CHG VPC15_MYCTU A:[2-132] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MIVDTSVWIAYLST------SESLASRW---LA-D--R--IAADSTVIVPE----VVMMELLIGKT-DEDT-----------AALRRRLL-Q-RF-AIE---PLA---PV----R-----DAE-DAA-----A--------I--------H---R--RCRR----GG----D-----TVR----SL------IDCQ-VAAMA-----L--------------RI------------------G---VAVAHRD---R-----DYE---AIRTH-CGLRTEPL-----------------------------------------------------------------------------------------------
8 HHSearch 63.6120% -39 - C3 -2LCQ - NOB1_PYRHO A:[5-129] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MLRNLKKTLVLDSSVFIQGID-------------------------------IEGYTTP----SVVEEIKDRES-KI-FL---E------SLISAGKV-K-IA-EPS---KES---I-----DRI---I---Q-V-----A--------K--------E---T--G-------EV----N-----EL-----SK------ADIE-VLALA-----Y--------------EL------------------K---GEIFSDD---Y-----NVQ---NIASL-LGLRFRTLKRGIKKVI---------------------------------------------------------------------------------------
22 HHSearch 62.9719% -62 - C3 -3ZVK - VAPC2_RICFE A:[2-124] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IYMLGTNICVYAINKHPDSYYN------N---LELL--A--K--NNTIAISS----IVLAELQYGVS-KSKK-----------KEQNQSKL-DIFL-SRL---EII---D-----FSA---KCTFY-Y-----G--------E--------L---R--T-------ELEQKGL-----II-----GN------NDLL-IASHA-----I--------------AE------------------N---ATLVTNNI--K-----EFK---RI-----------------------------------------------------------------------------------------------------------
14 HHSearch 62.3914% -61 - C3 -3H87 VAPC2_MYCTU A:[17-151] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TDQRWLIDKSALVRLTDS------PDME---I---WSNR--I--E--RGLVHITG----VTRLEVGFSAE-CGE-------------IARREFREP-PL-SAM---PVE---Y-----LT----P---R-IEDRALE--------V--------Q---T--LLADR---GHH---R-----GP-----SI------PDLL-IAATA-----E--------------LS------------------G---LTVLHVD---K-----DFD---AIAAL-TGQKTERLTH---------------------------------------------------------------------------------------------
28 Fugue 60.6715% -36 - C3 -2LCQ NOB1_PYRHO A:[5-165] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MLRNLKKTLVLDSSVFIQGI-------------------------------DIEGYTTP----SVVEEIKD-RE-SKIFL---E------SLISAGKV-K-IA-EPS---KES---I-----D-----R---I-I-----Q--------V--------A---K--ETG-----EV----N-----EL-----SK------ADIE-VLALA-----Y--------------EL------------------K---GEIFSDD---Y-----NVQ---NIASL-LGLRFRTLKRGIKKVIKWRYVCIGCGRKFSTLPPGGVC---PDC----GSKVKL-IPRKR-------------------------------------------
9 HHSearch 60.4616% -65 - C3 -2HWY - SMG5_HUMAN A:[855-1012] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PYLVPDTQALCHHL--------P------V---IRQLATS--G--RFIVIIPR----TVIDGLDLLK--EH--------------PGARDGI-R-YL-EAE---FKK---GNR---Y-----I---R-C-----Q------------------------------------------------------------LYK-ILDSC-----K--------------QL------------------TLAQ------L---PLDNPSVLSGALQAAAH-ASVDIKNVLDFYKQW----------------------------------------------------------------------------------------
34 Fugue 58.6610% -83 - C1 -3OKG ? A:[15-412] MTEGPYK--------------LPPGWRWVRLGEVCLPTERRDPTKNPSTYFVYVDISAIDSTVGKIVSPKEILGQHAPSRARKVIRSGDVIFATTRPYLKNIALVPPDLDGQICSTGFCVIRANREFAEPEFLFHLCRSDFITNQLTASKMRGTSYPAVTDNDVYNTLIPLPPLEEQRRIVAKVEALMERVREVRRLRAEAQKDTELLMQ------T------A---LAEV--F--P--HPGADLPPGWRWVRLGEVCDIIM-GQSPP---S------STYNFEGN-G-LP-FFQ---GKA---D-----F-----G---D-L-----H--------P--------T---P----------------R-----IW-----CS------APQK-VAR-----------------------P------------------G---DVLISVR---A-----PVG---STNVA-NLACCIG--RGLAALRPRDSLERFWLLYYLHYLEPELSKAITKKDLQNVFIPLPPLEEQRRIVAYLDQIQQQVAALKRAQAETEAELKRLEQAILDKAFRGDL
17 HHSearch 58.6513% -64 - C3 -2FE1 VAPC3_PYRAE A:[26-155] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MELVVDASAIAALYVP------EERSE--Q---AE-R--A--VSQAQELHTLD----LAAYEVANDLW-KHARR---G------LLREDEAS-N-ML-EEL---WEF---FK----A-----L---K-V-----HSYAE----V--------L---KDAFALA----LK----H-----GV-----TV------YDAA-YVALA-----E--------------KI------------------G---GKLLTLD---R-----QLA---EKFPA-LVT----------------------------------------------------------------------------------------------------
16 HHSearch 57.5414% -39 - C3 -1V8P VAPC9_PYRAE A:[27-157] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AVEYLVDASALYALAAH------Y------D---KWIK-----H--REKLAILH----LTIYEAGNALW-KEARLGRVD------WAAASRHL-K-KVLSSF---KVL---EDPP--L-----D---E-V-----L--------R--------V---A----------VE----R-----GL-----TF------YDAS-YAYVA-----E--------------SS------------------G---LVLVTQD---R-----ELL---AKTKG--AIDVETLLVRLAA-----------------------------------------------------------------------------------------
15 HHSearch 56.939% -85 - C3 -4MJ7 UTP23_YEAST A:[23-144] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REPYQVLVDNQLVLECNNSNF----N------LPSGLKRT--L--QA-DVKVMITQ----CCIQALYETRN--------------------DGAI-N-LA-KQF---ER----------------R---R-C-----N--------H--------S---F----------------K-----DP-----KS------PAEC-IESVVNISGAN--------------KH------------------R---YVVASQD---I-----DLR---RKLRTVPGVPLIHLTRS--------------------------------------------------------------------------------------------
18 HHSearch 55.8415% -65 - C3 -3DBO VAPC5_MYCTU B:[20-149] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PAAGVLDTSVFIA-----------------Q---LDEA--L--I--PDRVATTV----VTLAELRVGVL-AAATT---D--------IRAQRL-A-TL-ESV---ADM---E-----T-----L---P-V-----DDDAARMWAR--------L---R--I-------HLAESGR-----RV-----RI------NDLW-IAAVA-----A--------------SR------------------A---LPVITQD---D-----DFA---ALDGA-ASVEIIR------------------------------------------------------------------------------------------------