@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu01290: (2016-06-02 )
MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW

Atome Classification :

(20 SA) .........10........20........30........40........50........60
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
26 PsiBlast_CBE 98.3770%-155 - C13 -4LFA RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
6 PsiBlast_PDB 97.8170%-144 - C13 -1IBK RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
78 PsiBlast_CBE 97.6270%-135 - C13 -4AQY RS14Z_THET8 N:[1-60] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
69 PsiBlast_CBE 97.5870%-131 - C13 -4YHH RS14Z_THET8 N:[1-60] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
31 PsiBlast_CBE 97.5770%-146 - C13 -4LF5 RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
21 PsiBlast_CBE 97.5170%-148 - C13 -5BR8 RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
58 PsiBlast_CBE 97.4570%-147 - C13 -4DR2 RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
17 PsiBlast_PDB 97.2170%-141 - C13 -2HHH - RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
56 PsiBlast_CBE 97.1970%-143 - C13 -4DR4 RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
55 PsiBlast_CBE 97.1770%-136 - C13 -4DR5 RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
5 PsiBlast_PDB 97.1270%-143 - C13 -1HNZ - RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
12 PsiBlast_PDB 97.0970%-142 - C13 -1XMO RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
73 PsiBlast_CBE 96.8270%-142 - C13 -4GKJ RS14Z_THET8 N:[1-60] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
41 PsiBlast_CBE 96.7970%-128 - C13 -4JI1 RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
15 PsiBlast_PDB 96.7670%-136 - C13 -1XNR RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
8 PsiBlast_PDB 96.7070%-146 - C13 -1IBM RS14Z_THET8 N:[2-61] -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW