@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu01380: (2016-06-03 )
MIICKTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAERFIKKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGSRVLKDGDIISIDIGAKLNGYHGDSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENEQFSVVREYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVTVDGKKCAHFEHTIAITETGFDILTRV

Atome Classification :

(79 SA) ....--.....10........20........30........40.......-.50.....-...60........70........80.-........90........100.......110.......120.......130.......140.......150-.....--..----.----160.......170.......180.......190.......200.......-210-.......220.......230.......240......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MIIC--KTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAERFI-KKQGAIPS-FKGYNGFRGSICVSVNEELVHGIP-G-SRVLKDGDIISIDIGAKLNGYHGDSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQ--TYVEN--EQ----F----SVVREYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSR-YVK-TLADNWTVVTVDGKKCAHFEHTIAITETGFDILTRV
120 HHSearch 94.4650% -71 - C2 -3TAV ? A:[30-284] -KTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVI-REAGAVPS-FLGYHGFPASICSSVNDQVVHGIP-SATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIE--LGTRAAEKQFDRAF----GIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTT-QTR-VLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTM-
115 HHSearch 93.4145% -78 - C2 -3TB5 ? A:[1-247] MITL--KSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFI-ESHGGVAA-QIGYEGYKYATCCSINDEICHGFP-R-KKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGESTPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQ--TYVEG--EG----Y----GVVRDFVGHGIGPTIHESPMIPHYGEAGKGLRLKEGMVITIEPMVNTGTW-RMK-MDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILTS-
1 PsiBlast_PDB 92.6051% -75 - C2 -1O0X - ? A:[6-253] MIRI--KTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIF-KKLRVKPA-FKGYGGYKYATCVSVNEEVVHGLPLK-EKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQ--ETVES--VG----F----NVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDW-RVV-VKEDGWTAVTVDGSRCAHFEHTILITENGAEILTK-
3 PsiBlast_PDB 92.5645% -79 - C2 -3TB5 ? A:[1-246] MITL--KSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFI-ESHGGVAA-QIGYEGYKYATCCSINDEICHGFP-R-KKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGESTPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQ--TYVEG--EG----Y----GVVRDFVGHGIGPTIHESPMIPHYGEAGKGLRLKEGMVITIEPMVNTGTW-RMK-MDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILT--
121 HHSearch 91.6151% -75 - C2 -1O0X - ? A:[6-253] MIRI--KTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIF-KKLRVKPA-FKGYGGYKYATCVSVNEEVVHGLP-LKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQ--ETVES--VG----F----NVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDW-RVV-VKEDGWTAVTVDGSRCAHFEHTILITENGAEILTK-
2 PsiBlast_PDB 90.8650% -67 - C2 -3TAV ? A:[35-283] ------RTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVI-REAGAVPS-FLGYHGFPASICSSVNDQVVHGIPSA-TAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAE--KQ----FDRAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTT-QTR-VLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILT--
41 PsiBlast_CBE 90.3646% -71 - C2 -4A6V ? A:[6-249] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
68 PsiBlast_CBE 90.1541% -78 - C2 -3MR1 MAP1_RICPR B:[5-251] MIKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFI-TSHNAIPA-PLNYKGFPKSICTSINHVVCHGIP-N-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQ--SYAEK--HN----Y----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTIL-SKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFT--
4 PsiBlast_PDB 90.0746% -72 - C2 -3MAT MAP1_ECOLI A:[6-249] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
76 PsiBlast_CBE 90.0242% -76 - C2 -4IDY MAP12_MYCTU A:[48-289] ------QTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYL-VDNGAYPS-TLGYKGFPKSCCTSLNEVICHGIP-D-STVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIE--SYANR--FG----Y----NVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGAL-DYE-IWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILT--
119 HHSearch 89.9546% -74 - C2 -2GG2 MAP1_ECOLI A:[1-249] AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYI-VNEQHAVSACLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTL-
12 PsiBlast_PDB 89.8146% -73 - C2 -1C22 MAP1_ECOLI A:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
5 PsiBlast_PDB 89.8046% -72 - C2 -2MAT MAP1_ECOLI A:[6-249] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
66 PsiBlast_CBE 89.7641% -75 - C2 -3MR1 MAP1_RICPR D:[5-251] MIKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFI-TSHNAIPA-PLNYKGFPKSICTSINHVVCHGIP-N-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQ--SYAEK--HN----Y----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTIL-SKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFT--
84 PsiBlast_CBE 89.4842% -75 - C2 -1Y1N MAP12_MYCTU A:[48-289] ------QTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYL-VDNGAYPS-TLGYKGFPKSCCTSLNEVICHGIP-D-STVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIE--SYANR--FG----Y----NVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGAL-DYE-IWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILT--
22 PsiBlast_CBE 89.4645% -80 - C2 -3TB5 ? B:[1-246] MITL--KSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFI-ESHGGVAA-QIGYEGYKYATCCSINDEICHGFP-R-KKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGESTPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQ--TYVEG--EG----Y----GVVRDFVGHGIGPTIHESPMIPHYGEAGKGLRLKEGMVITIEPMVNTGTW-RMK-MDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILT--
45 PsiBlast_CBE 89.3746% -73 - C2 -2GU6 MAP1_ECOLI B:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
69 PsiBlast_CBE 89.3341% -74 - C2 -3MR1 MAP1_RICPR A:[5-251] MIKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFI-TSHNAIPA-PLNYKGFPKSICTSINHVVCHGIP-N-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQ--SYAEK--HN----Y----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTIL-SKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFT--
14 PsiBlast_PDB 89.2946% -72 - C2 -1C24 MAP1_ECOLI A:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
49 PsiBlast_CBE 89.2246% -72 - C2 -2GU4 MAP1_ECOLI B:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
16 PsiBlast_PDB 89.2146% -73 - C2 -2BB7 MAP1_ECOLI A:[6-249] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
52 PsiBlast_CBE 89.0946% -73 - C2 -2GTX MAP1_ECOLI B:[3-246] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
30 PsiBlast_CBE 89.0446% -73 - C2 -2GG8 MAP1_ECOLI A:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
34 PsiBlast_CBE 89.0046% -73 - C2 -2GG2 MAP1_ECOLI A:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
118 HHSearch 88.9642% -75 - C2 -3PKA MAP12_MYCTU A:[38-285] EPWV--QTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYL-VDNGAYPS-TLGYKGFPKSCCTSLNEVICHGIP-D-STVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIE--SYANR--FG----Y----NVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGAL-DYE-IWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL
83 PsiBlast_CBE 88.9442% -75 - C2 -1YJ3 MAP12_MYCTU A:[48-289] ------QTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYL-VDNGAYPS-TLGYKGFPKSCCTSLNEVICHGIP-D-STVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIE--SYANR--FG----Y----NVVRDFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGAL-DYE-IWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILT--
27 PsiBlast_CBE 88.8546% -74 - C2 -2GGC MAP1_ECOLI A:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
70 PsiBlast_CBE 88.7541% -73 - C2 -3MX6 MAP1_RICPR B:[5-251] MIKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFI-TSHNAIPA-PLNYKGFPKSICTSINHVVCHGIP-N-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQ--SYAEK--HN----Y----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTIL-SKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFT--
33 PsiBlast_CBE 88.7046% -72 - C2 -2GG3 MAP1_ECOLI A:[5-248] ------KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIP-DDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQ--KFVEA--EG----F----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKK-EIR-TMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
71 PsiBlast_CBE 88.6141% -71 - C2 -3MX6 MAP1_RICPR A:[6-251] -IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFI-TSHNAIPA-PLNYKGFPKSICTSINHVVCHGIP-N-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQ--SYAEK--HN----Y----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTIL-SKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFT--
117 HHSearch 88.5841% -68 - C2 -3MX6 MAP1_RICPR A:[6-252] -IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFI-TSHNAIPA-PLNYKGFPKSICTSINHVVCHGIP-N-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQ--SYAEK--HN----Y----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNY-DTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL-