@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu01450: (2016-06-03 )
MNQNQLISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYAEGPPEEIFKLNKELVRIGLDLPFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM

Atome Classification :

(61 SA) .........10....---...-.--20-...--..-....30........40........50........60....---.--...70------------....---..----...80...-.....90........100......-.110-.........120.......130..-.-..---..-----------..140---------.........150.......-160.......170.......180.....-..190.......200....-.-.-.210...-....220.......-------230-------.-----.......--.240.----......250.......260.......270.......280-------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNQNQLISVEDIVFR---YRK-D--A--ERR--AL-DGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGD---I--EVAG-------------IQLT---EE----SVWEVRKK-IGMVFQNPDNQFVGTTVRDDVAFG-LE---NNGVPREEMIERVDWAVKQV--NM-Q-DF---LD-----------QEP-----------HHLSGGQKQRVAIAGVIAA-RPDIIILDEATSMLDPIGREEVLETVRH-LKEQGMATVISITHDLNEA-A-K-ADRIIVM-NGGKKYAEGPPEEI-------F---------K-----LNKELVR--IGLDL----PFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM--------------------------------------------------
1 PsiBlast_PDB 97.3053% -92 - C1 -5D3M ? A:[21-298] ---DNIISFDHVTFT---Y-P-D--S--PRP--AL-SDLSFAIERGSWTALIGHNGSGKSTVSKLINGLLAPDDLDKSSI--TVDG-------------VKLG---AD----TVWEVREK-VGIVFQNPDNQFVGATVSDDVAFG-LE---NRAVPRPEMLKIVAQAVADV--GM-A-DY---AD-----------SEP-----------SNLSGGQKQRVAIAGILAV-KPQVIILDESTSMLDPEGKEQILDLVRK-IKEDNNLTVISITHDLEEA-A-G-ADQVLVL-DDGQLLDQGKPEEI-------F---------P-----KVEMLKR--IGLDI----PFVYRLKQLLKERGIVLPDEIDDDEKLVQSLWQLNS----------------------------------------------------
123 HHSearch 94.6453% -86 - C1 -4HUQ - ECFA1_LACBA B:[3-276] ---ENIISVDHLTYQ---YDE----N--QAP--AL-TDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGS---V--TVGG-------------ITLT---PE----TVWQVREQ-IGMIFQNPDNQFVGATVEDDVAFG-LE---NRQISRDEMVPRVQAALAQV--GM-T-SF---AQ-----------REP-----------SSLSGGQKQRVALAGIVAI-APKILILDEATSMLDPQGRIEMLAIVRQLRQQQNL-TVISITHDIDEA-A-S-ADRVLVI-DDGRLVDEAVPSQI-------F---------E-----RGTQLVE--MGLDL----PFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSL-----------------------------------------------------
2 PsiBlast_PDB 94.2853% -82 - C1 -4HUQ - ECFA1_LACBA B:[3-273] --EN-IISVDHLTYQ---YDE-N-----QAP--AL-TDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGS---V--TVGG-------------ITLT---PE----TVWQVREQ-IGMIFQNPDNQFVGATVEDDVAFG-LE---NRQISRDEMVPRVQAALAQV--GM-T-SF---AQ-----------REP-----------SSLSGGQKQRVALAGIVAI-APKILILDEATSMLDPQGRIEMLAIVRQ-LRQQQNLTVISITHDIDEA-A-S-ADRVLVI-DDGRLVDEAVPSQI-------F---------E-----RGTQLVE--MGLDL----PFTEKLKAALRQRGITPPTTYQTAAEMEEWLW--------------------------------------------------------
3 PsiBlast_PDB 90.5053% -77 - C1 -4HZU - ECFA1_LACBA A:[2-273] -TEN-IISVDHLTYQ---Y---------QAP--AL-TDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGS---V--TVGG-------------ITLT---PE----TVWQVREQ-IGMIFQNPDNQFVGATVEDDVAFG-LE---NRQISRDEMVPRVQAALAQV--GM-T-SF---AQ-----------REP-----------SSLSGGQKQRVALAGIVAI-APKILILDEATSMLDPQGRIEMLAIVRQ-LRQQQNLTVISITHDIDEA-A-S-ADRVLVI-DDGRLVDEAVPSQI-------F---------E-----RGTQLVE--MGLDL----PFTEKLKAALRQRGITPPTTYQTAAEMEEWLW--------------------------------------------------------
122 HHSearch 84.9540% -89 - C1 -4MKI ECFA2_CALS4 B:[5-283] ----MPIKVENVSFI---YNE-GTPY--ATV--AL-KDINFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGK---I--YING-------------IDIT---DKKV--SLKDIRKQ-VGLVFQYPEYQLFEETVFKDIAFG-PS---NLGLSEEEVKERVYEAMEIV--GI-SKEL---AD-----------KSP-----------FELSGGQKRRVAIAGILAM-RPKILILDEPTAGLDPKGKQEILNKIKEIHDKYKM-ITILVSHNMEDI-ARI-ADKIIVM-NRGKIELIGTPREV-------F---------R-----EAERLEK--IGLSV----PQITSLARELRKRGVPIPPDVLTIEEAKEHILRY------------------------------------------------------
121 HHSearch 82.3438% -89 - C1 -4HUQ - ECFA2_LACBA A:[2-279] -----AIAFEHVTYT---YQA-G--TPMAHT--AL-TDVSLTVPDRGYLAIIGHTGSGKSTLIQQLNALLKPTSGT---I--KIDE-------------FTIT---PETTNAALKPLRQH-VGMVFQFPENQLFEETVRQDIAFG-PK---NFGMADADALALADEMLTTV--GL-DQSY---AE-----------RSP-----------FELSGGQMRRVAIAGVLAM-QPKVLVLDEPTAGLDPQGRQEMMRLFARLHQEQGL-TIVLVTHQMEDV-AQY-AEQVAVM-HEGRLMKFGTPADV-------F---------S-----NREWLQD--HQLDV----PQAAQFARRLRDRGLTFPKQPLTADQLADYLA--------------------------------------------------------
21 PsiBlast_CBE 81.9640% -91 - C1 -4MKI ECFA2_CALS4 A:[3-274] --RPMPIKVENVSFI---YNE-G--T--PYATVAL-KDINFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGK---I--YING-------------IDIT---DKKV--SLKDIRKQ-VGLVFQYPEYQLFEETVFKDIAFG-PS---NLGLSEEEVKERVYEAMEIV--GISK-EL---AD-----------KSP-----------FELSGGQKRRVAIAGILAM-RPKILILDEPTAGLDPKGKQEILNKIKE-IHDKYKMITILVSHNMEDI-A-RIADKIIVM-NRGKIELIGTPREV-------F---------R-----EAERLEK--IGLSV----PQITSLARELRKRGVPIPPDVLTIE---------------------------------------------------------------
4 PsiBlast_PDB 81.8340% -89 - C1 -4MKI ECFA2_CALS4 B:[5-274] ----MPIKVENVSFI---YNE-G--T--PYATVAL-KDINFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGK---I--YING-------------IDIT---DKKV--SLKDIRKQ-VGLVFQYPEYQLFEETVFKDIAFG-PS---NLGLSEEEVKERVYEAMEIV--GISK-EL---AD-----------KSP-----------FELSGGQKRRVAIAGILAM-RPKILILDEPTAGLDPKGKQEILNKIKE-IHDKYKMITILVSHNMEDI-A-RIADKIIVM-NRGKIELIGTPREV-------F---------R-----EAERLEK--IGLSV----PQITSLARELRKRGVPIPPDVLTIE---------------------------------------------------------------
117 Fugue 77.4130% -90 - C1 -3TUZ METN_ECOLI H:[23-362] ----HMIKLSNITKV---FHQGT--R--TIQ--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQHF-NLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------FSHPKTPLAQK-----FIQSTLH--LDIPE----DYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEV
18 PsiBlast_PDB 74.0234% -87 - C1 -3TUI METN_ECOLI C:[42-277] ------------------------------Q--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQH-FNLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------F---------SHPKTPLAQKFIQSTLHLDI----PEDYQ-----------------------------------------------------------------------------------
32 PsiBlast_CBE 73.6234% -88 - C1 -3TUI METN_ECOLI H:[42-277] ------------------------------Q--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQH-FNLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------F---------SHPKTPLAQKFIQSTLHLDI----PEDYQ-----------------------------------------------------------------------------------
30 PsiBlast_CBE 73.2934% -90 - C1 -3TUZ METN_ECOLI G:[42-277] ------------------------------Q--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQH-FNLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------F---------SHPKTPLAQKFIQSTLHLDI----PEDYQ-----------------------------------------------------------------------------------
19 PsiBlast_PDB 73.1134% -90 - C1 -3TUZ METN_ECOLI C:[42-277] ------------------------------Q--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQH-FNLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------F---------SHPKTPLAQKFIQSTLHLDI----PEDYQ-----------------------------------------------------------------------------------
33 PsiBlast_CBE 73.0934% -86 - C1 -3TUI METN_ECOLI G:[42-277] ------------------------------Q--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQH-FNLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------F---------SHPKTPLAQKFIQSTLHLDI----PEDYQ-----------------------------------------------------------------------------------
139 HHSearch 72.4338% -94 - C1 -3GFO ECFA3_CLOP1 A:[5-254] ---DYILKVEELNYN---YSD-------GTH--AL-KGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGR---I--LFDN-------------KPID---YSRK--GIMKLRES-IGIVFQDPDNQLFSASVYQDVSFG-AV---NMKLPEDEIRKRVDNALKRT--GI-E-HL---KD-----------KPT-----------HCLSFGQKKRVAIAGVLVM-EPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGI-TIIIATHDIDIV-PLY-CDNVFVM-KEGRVILQGNPKEV-------F---------A-----EKEVIRK--VNLRL----PRIGHLMEI-------------------------------------------------------------------------------
34 PsiBlast_CBE 72.1534% -84 - C1 -3TUI METN_ECOLI D:[42-277] ------------------------------Q--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQH-FNLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------F---------SHPKTPLAQKFIQSTLHLDI----PEDYQ-----------------------------------------------------------------------------------
5 PsiBlast_PDB 72.0735% -92 - C1 -3GFO ECFA3_CLOP1 A:[4-254] --EDYILKVEELNYN---YSD-G--T----H--AL-KGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGR---ILFDNKP-------------IDYS---RK----GIMKLRES-IGIVFQDPDNQLFSASVYQDVSFG-AV---NMKLPEDEIRKRVDNALKRT--GI-E-HL---KD-----------KPT-----------HCLSFGQKKRVAIAGVLVM-EPKVLILDEPTAGLDPMGVSEIMKLLVE-MQKELGITIIIATHDIDIV-PLY-CDNVFVM-KEGRVILQGNPKEV-------F---------A-----EKEVIRK--VNLRL----PRIGHLMEI-------------------------------------------------------------------------------
29 PsiBlast_CBE 71.9434% -88 - C1 -3TUZ METN_ECOLI H:[42-277] ------------------------------Q--AL-NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS---V--LVDG-------------QELTTLSES----ELTKARRQ-IGMIFQH-FNLLSSRTVFGNVALP-LE---LDNTPKDEVKRRVTELLSLV--GL-G-DK---HD-----------SYP-----------SNLSGGQKQRVAIARALAS-NPKVLLCDQATSALDPATTRSILELLKD-INRRLGLTILLITHEMDVV-K-RICDCVAVI-SNGELIEQDTVSEV-------F---------SHPKTPLAQKFIQSTLHLDI----PEDYQ-----------------------------------------------------------------------------------
11 PsiBlast_PDB 71.0440% -85 - C1 -4U02 ? A:[20-231] ----------------------------------L-KGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGE---V--VVDG-------------LSVK---DDR---ALREIRRE-VGMVFQQ-FNLFPHMTVLENVTLAPMR---VRRWPREKAEKKALELLERV--GI-L-DQ---AR-----------KYP-----------AQLSGGQQQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLDVMRD-LAQGGM-TMVVVTHEMGFA-R-EVADRVVFM-DGGQIVEEGRPEEI-------F---------T-----RPKE------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 70.9640% -87 - C1 -4U00 ? A:[20-231] ----------------------------------L-KGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGE---V--VVDG-------------LSVK---DDR---ALREIRRE-VGMVFQQ-FNLFPHMTVLENVTLAPMR---VRRWPREKAEKKALELLERV--GI-L-DQ---AR-----------KYP-----------AQLSGGQQQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLDVMRD-LAQGGM-TMVVVTHEMGFA-R-EVADRVVFM-DGGQIVEEGRPEEI-------F---------T-----RPKE------------------------------------------------------------------------------------------------------
118 Fugue 70.9535% -87 - C1 -1B0U HISP_SALTY A:[5-261] ----NKLHVIDLHKR---YGG--------HE--VLK-GVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGA---I--IVNGQNINLVRDKDGQLKVAD---KN----QLRLLRT-RLTMVFQHF-NLWSHMTVLENVMEA-PIQVL--GLSKHDARERALKYLAKV--GI-D-ERAQG-------------KYP-----------VHLSGGQQQRVSIARALAME-PDVLLFDEPTSALDPELVGEVLRIMQQ-LAEE-GKTMVVVTHEMGFA-R-HVSSHVIFLH-QGKIEEEGDPEQV-------F---------G-----NP-Q---------------------------------SPRLQQFLKGSLKKLE-----------------------------------------------------
48 PsiBlast_CBE 69.6237% -94 - C1 -2OLK ? C:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
49 PsiBlast_CBE 69.3937% -91 - C1 -2OLK ? B:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
50 PsiBlast_CBE 68.8237% -92 - C1 -2OLK ? A:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 68.6437% -89 - C1 -4YMV ? J:[1-224] -----MIFVNDV------YKN-F--G--SLE--VL-KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGE---V--FIDG-------------VKINNG-KV----NINKVRQK-VGMVFQH-FNLFPHLTAIENITLAPVK---VKKMNKKEAEELAVDLLAKV--GL-L-DK---KD-----------QYP-----------IKLSGGQKQRLAIARALAM-QPEVMLFDEPTSALDPEMVKEVLNVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVIFM-DDGVIVEEGTPEEI-------F-------------------------------------------------------------------------------------------------------------------------
38 PsiBlast_CBE 68.1937% -91 - C1 -3C41 ? J:[19-226] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
47 PsiBlast_CBE 68.0737% -90 - C1 -2OLK ? D:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
28 PsiBlast_CBE 68.0637% -94 - C1 -4YMU ? A:[1-224] -----MIFVNDV------YKN-F--G--SLE--VL-KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGE---V--FIDG-------------VKINNG-KV----NINKVRQK-VGMVFQH-FNLFPHLTAIENITLAPVK---VKKMNKKEAEELAVDLLAKV--GL-L-DK---KD-----------QYP-----------IKLSGGQKQRLAIARALAM-QPEVMLFDEPTSALDPEMVKEVLNVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVIFM-DDGVIVEEGTPEEI-------F-------------------------------------------------------------------------------------------------------------------------
42 PsiBlast_CBE 67.6137% -89 - C1 -2Q0H ? A:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
52 PsiBlast_CBE 67.5337% -89 - C1 -2OLJ ? A:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
39 PsiBlast_CBE 67.0337% -89 - C1 -3C4J ? B:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 66.9837% -92 - C1 -4YMU ? J:[1-224] -----MIFVNDV------YKN-F--G--SLE--VL-KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGE---V--FIDG-------------VKINNG-KV----NINKVRQK-VGMVFQH-FNLFPHLTAIENITLAPVK---VKKMNKKEAEELAVDLLAKV--GL-L-DK---KD-----------QYP-----------IKLSGGQKQRLAIARALAM-QPEVMLFDEPTSALDPEMVKEVLNVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVIFM-DDGVIVEEGTPEEI-------F-------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 66.8237% -90 - C1 -4YMV ? A:[1-224] -----MIFVNDV------YKN-F--G--SLE--VL-KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGE---V--FIDG-------------VKINNG-KV----NINKVRQK-VGMVFQH-FNLFPHLTAIENITLAPVK---VKKMNKKEAEELAVDLLAKV--GL-L-DK---KD-----------QYP-----------IKLSGGQKQRLAIARALAM-QPEVMLFDEPTSALDPEMVKEVLNVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVIFM-DDGVIVEEGTPEEI-------F-------------------------------------------------------------------------------------------------------------------------
37 PsiBlast_CBE 66.6237% -89 - C1 -3C41 ? K:[19-226] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
40 PsiBlast_CBE 66.5737% -84 - C1 -3C4J ? A:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 65.8838% -67 - C1 -4HLU ECFA2_THEMA A:[3-262] -GRIEVVNVSHI-FH---RGT-P--L--EKK--AL-ENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGD---V--LYDG----------------E---RK----KGYEIRRN-IGIAFQYPEDQFFAERVFDEVAFA-VK---NF-YPDRDPVPLVKKAMEFVGLDF-D-SF---KD-----------RVP-----------FFLSGGEKRRVAIASVIVH-EPDILILDEPLVGLDREGKTDLLRIVEK-WKTLG-KTVILISHDIETV-I-NHVDRVVVL-EKGKKVFDGTRMEFLEKYDPRF---------F-----TSKMLVM--RRLVLKGEDPFSMSDDELL------------------------------------------------------------------------------
36 PsiBlast_CBE 65.7135% -90 - C1 -4HLU ECFA1_THEMA C:[12-242] ------IELNSVSFR---YNG-D--Y-------VL-KDVNAEFETGKIYVVVGKNGSGKTTLLKILAGL-LAAAGE---I--FLDG----------------S---PA----DPFLLRKN-VGYVFQNPSSQIIGATVEEDVAFS-LE---IMGLDESEMRKRIKKVLELV--GL-S-GL---AA-----------ADP-----------LNLSGGQKQRLAIASMLAR-DTRFLALDEPVSMLDPPSQREIFQVLES-LKNEGKG-IILVTHELEYL-D-D-MDFILHI-SNGTIDFCGSWEEF-------V---------E-----REFDDVE--I--------PFKWKL----------------------------------------------------------------------------------
41 PsiBlast_CBE 65.5937% -89 - C1 -2Q0H ? B:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 64.9638% -66 - C1 -4HLU ECFA2_THEMA B:[3-262] -GRIEVVNVSHI-FH---RGT-P--L--EKK--AL-ENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGD---V--LYDG----------------E---RK----KGYEIRRN-IGIAFQYPEDQFFAERVFDEVAFA-VK---NF-YPDRDPVPLVKKAMEFVGLDF-D-SF---KD-----------RVP-----------FFLSGGEKRRVAIASVIVH-EPDILILDEPLVGLDREGKTDLLRIVEK-WKTLG-KTVILISHDIETV-I-NHVDRVVVL-EKGKKVFDGTRMEFLEKYDPRF---------F-----TSKMLVM--RRLVLKGEDPFSMSDDELL------------------------------------------------------------------------------
51 PsiBlast_CBE 64.4137% -87 - C1 -2OLJ ? B:[40-247] ----------------------------------L-KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGE---I--IIDG-------------INLKAK-DT----NLNKVREE-VGMVFQR-FNLFPHMTVLNNITLAPMK---VRKWPREKAEAKAMELLDKV--GL-K-DK---AH-----------AYP-----------DSLSGGQAQRVAIARALAM-EPKIMLFDEPTSALDPEMVGEVLSVMKQ-LANEGM-TMVVVTHEMGFA-R-EVGDRVLFM-DGGYIIEEGKPEDL-------F-------------------------------------------------------------------------------------------------------------------------
57 PsiBlast_CBE 64.2535% -89 - C1 -2FF7 A:[8-231] ------ITFRNIRFR---YKP-D--S--PV---IL-DNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ---V--LIDG-------------HDLA---LA----DPNWLRRQ-VGVVLQ--DNVLLNRSIIDNIS---LA---NPGMS----VEKVIYAAKLA--GA-H-DF---ISELREGYNTIVGEQG-----------AGLSGGQRQRIAIARALVN-NPKILIFDEATSALD-YESEHVIMRNMH-KICKG-RTVIIIAHRLSTV-K-N-ADRIIVM-EKGKIVEQGKHKEL-------L-------------------------------------------------------------------------------------------------------------------------
55 PsiBlast_CBE 64.1535% -80 - C1 -4S0F ? B:[488-713] ----------DIEFRNVDFRY-G--L--RKP--VL-KNINLTIPKGKTVAIVGESGSGKTTLAKLLMNFYSPEKGD---I--LING-------------HSIK---NI----SLELIRKK-IAFVSQ--DVFIFSGTVKENLCLG-NE---N--VDMDEIIK----AAKMA--NA-H-DF---IE-----------KLPLKYDTFLNESGANLSEGQKQRLAIARALLK-KPDILILDQATSNLDSITENHIKDAIYG-LEDD--VTVIIIAHRLSTI-V-N-CDKIYLL-KDGEIVESGSHTEL-------I---------A-----L---------------------------------------------------------------------------------------------------------
59 PsiBlast_CBE 64.0335% -92 - C1 -2PMK A:[4-227] ------ITFRNIRFR---YKP-D--S--PV---IL-DNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ---V--LIDG-------------HDLA---LA----DPNWLRRQ-VGVVLQ--DNVLLNRSIIDNIS---LA---NPGMS----VEKVIYAAKLA--GA-H-DF---ISELREGYNTIVGEQG-----------AGLSGGQRQRIAIARALVN-NPKILIFDEATSALD-YESEHVIMRNMH-KICKG-RTVIIIAHRLSTV-K-N-ADRIIVM-EKGKIVEQGKHKEL-------L-------------------------------------------------------------------------------------------------------------------------
56 PsiBlast_CBE 64.0035% -77 - C1 -4S0F ? A:[488-713] ----------DIEFRNVDFRY-G--L--RKP--VL-KNINLTIPKGKTVAIVGESGSGKTTLAKLLMNFYSPEKGD---I--LING-------------HSIK---NI----SLELIRKK-IAFVSQ--DVFIFSGTVKENLCLG-NE---N--VDMDEIIK----AAKMA--NA-H-DF---IE-----------KLPLKYDTFLNESGANLSEGQKQRLAIARALLK-KPDILILDQATSNLDSITENHIKDAIYG-LEDD--VTVIIIAHRLSTI-V-N-CDKIYLL-KDGEIVESGSHTEL-------I---------A-----L---------------------------------------------------------------------------------------------------------
95 PsiBlast_CBE 62.6934% -80 - C1 -2FGJ HLYBP_ECOLX B:[8-231] ------ITFRNIRFR---YKP-D--S--PV---IL-DNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ---V--LIDG-------------HDLA---LA----DPNWLRRQ-VGVVLQ--DNVLLNRSIIDNIS---LA---NPGMS----VEKVIYAAKLA--GA-H-DF---ISELREGYNTIVGEQG-----------AGLSGGQRQRIAIARALVN-NPKILIFDEATSALD-YESEHVIMRNMH-KICKGR-TVIIIAARLSTV-K-N-ADRIIVM-EKGKIVEQGKHKEL-------L-------------------------------------------------------------------------------------------------------------------------
54 PsiBlast_CBE 62.5934% -85 - C1 -1VCI ? A:[27-237] ---------------------------------AV-NKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGR---I--YFGD-------------RDVT---YL----PPKD--RN-ISMVFQ-------HMTVYENIAFP-L-----KKFPKDEIDKRVRWAAELL--QI-E-EL---LN-----------RYP-----------AQLSGGQRQRVAVARAIVV-EPDVLLMDEPLSNLDAKLRVAMRAEIKK-LQQKLKVTTIYVTHDQVEAMT-M-GDRIAVM-NRGQLLQIGSPTEV-------Y-------------------------------------------------------------------------------------------------------------------------
97 PsiBlast_CBE 62.2334% -90 - C1 -2FFA A:[8-231] ------ITFRNIRFR---YKP-D--S--PV---IL-DNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ---V--LIDG-------------HDLA---LA----DPNWLRRQ-VGVVLQ--DNVLLNRSIIDNIS---LA---NPGMS----VEKVIYAAKLA--GA-H-DF---ISELREGYNTIVGEQG-----------AGLSGGQRQRIAIARALVN-NPKILIFDEATSALD-YESEHVIMRNMH-KICKGR-TVIIIAARLSTV-K-N-ADRIIVM-EKGKIVEQGKHKEL-------L-------------------------------------------------------------------------------------------------------------------------
64 PsiBlast_CBE 61.9634% -85 - C1 -2FFB A:[8-231] ------ITFRNIRFR---YKP-D--S--PV---IL-DNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ---V--LIDG-------------HDLA---LA----DPNWLRRQ-VGVVLQ--DNVLLNRSIIDNIS---LA---NPGMS----VEKVIYAAKLA--GA-H-DF---ISELREGYNTIVGEQG-----------AGLSGGQRQRIAIARALVN-NPKILIFDQATSALD-YESEHVIMRNMH-KICKG-RTVIIIAHRLSTV-K-N-ADRIIVM-EKGKIVEQGKHKEL-------L-------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 61.7538% -69 - C1 -4ZIR ECFA2_THEMA A:[2-261] -GRIEVVNVSHI-FH---RGT-P--L--EKK--AL-