@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu01590: (2016-06-03 )
MPLLTPTSVVLGVLLSQFLNGYEWAVPWIFAFITFAGSLSANFQSLRHALSHPLPMILALFVLHIFMPLFAWGSGHLIFKGDPLTITGLTLAVVIPTGITSLIWAAMYKGNVGLTLSIILVDTVLSPLIVPLSLSLLAGAQVHMDVWGMMKGLIVMVVIPSFLGMLFNQMSSPERTAFVSSALSPFSKLCLMAVIAINSSAIAPYFKSIDLRFAGIAVTVFFIALTGYAAAWLIGKMMKRRQEEIVSLIFTGGMRNISAGAVLAVTFFPSQVAVPVVIGMLFQQILAALFGYMLNRFELKPMLQKA

Atome Classification :

(20 SA) ------------------------------------------------------------------------------------------------------.....----....10--....-----...-----.20....---..-..30..---......40..-------..--------....50........60-........70--..--.----------.-------------...---------------------------------.80-----.--.--......90--....-.------.--...100------..---.....----.--.110---.-.-....-.120...----------.--------....130---------.......140-.......---.--.150.......160------------......------.-.170.........180.......190----.........200-.-...-------....210.-------------------------....-----------------..220--------..-.----..----...230......---------.240.......250.--------......260----.......---------------.--270....---.-----------------....----------------280..-.....290-----...---------.....300.....-----------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------------------------------------------------------------------------------------------------------MPLLT----PTSVVL--GVLL-----SQF-----LNGYEWA---VP-WIFAFI---TFAGSLSANF-------QS--------LRHALSHPLPMILALF-VLHIFMPLFA--WG--S----------G-------------HLI---------------------------------FKG-----D--P--LTITGLT---LAVV-I------P--TGIT--------SL---IWAAM----Y--KGNV---G-L-TLSI-IL-VDTV----------L--------SPLIVPL---------SLSLLAGA---QVHMDVW---G--MMKGLIVMVVIPS-------------FLGMLF------N-QM--SSPERTAFVSSALSPFSKLC------LMAVIAINSSA--I-APY-------FKSIDLRF-------------------------AGIA-----------------VTVF---------FI-A----LT----GYAAAWLIGKMM---------KRRQEEIVSLIFTGG--------MRNISAGA-----VLAVTFF---------------P--S--QVAV---P-----------------VVIG----------------MLFQQ-ILAALFG------YML---------NRFELK-PMLQKA-----------------------------
19 Fugue 96.0620%-152 - C4 -3ZUY ? A:[2-309] -----------------------------------------------------------------------------------------NILSKISSFIGKTFSLWA----ALFAAA--AFFA-----PDT-----FKWAGPY---IP-WLLGII---MFGMGLTLKP-------SD--------FDILFKHPKVVIIGVI-AQFAIMPATA--WL--L----------S-------------KL----------------------------------LNL-----P--A--EIAVGVI---LVGC-C------P--GGTA--------SN---VMTYL----A--RGNV---A-L-SVAV-TS-VSTL----------I--------SPLLTPA---------IFLMLAGE---MLEIQAA---G--MLMSIVKMVLLPI-------------VLGLIV------H-KV--LG----SKTEKLTDALPLVS------VAAIVLIIGAV--V-GAS-------KGKIMESG-------------------------LLIF-----------------AVVV---------LH-N----GI----GYLLGFFAAKWT---------GLPYDAQKTLTIEVG--------MQNSGLAA-----ALAAAHF---------------A--AAPVVAV---P-----------------GALF----------------SVWHN-ISGSLLA------TYW---------AAKA--------------------------------------
10 HHSearch 96.0622%-143 - C4 -3ZUX ? A:[21-314] -------------------------------------------------------------------------------------------------------SLWA----ALFAAA--AFFA-----PDT-----FKWAGPY---IP-WLLGII---MFGMGLTLKP-------SD--------FDILFKHPKVVIIGVI-AQFAIMPATA--WC--L----------S-------------KL----------------------------------LNL-----P--A--EIAVGVI---LVGC-C------P--GGTA--------SN---VMTYL----A--RGNV---A-L-SVAV-TS-VSTL----------T--------SPLLTPA---------IFLMLAGE---MLEIQAA---G--MLMSIVKMVLLPI-------------VLGLIV------H-KV--LGSK-TEKLTDALPLVSVAA------IVLIIGAVVGA--S-KGK-------IMESGL----------------------------LIF-----------------AVVV---------LH-N----GI----GYLLGFFAAKWT---------GLPYDAQKALTIEVG--------MQNSGLAA-----ALAAAHF---------------AAAP--VVAV---P-----------------GALF----------------SVWHN-ISGSLLA------TYW---------AAKA--------------------------------------
9 HHSearch 95.5822%-143 - C4 -4N7W ? A:[10-307] -------------------------------------------------------------------------------------------------------PVWA----LLLSVA--AYFR-----PTT-----FTGIGPY---VG-PLLMLI---MFAMGVTLRL-------DD--------FKRVLSRPAPVAAATF-LHYLIMPLTA--WI--L----------A-------------ML----------------------------------FRM-----P--P--DLSAGMV---LVGS-V------A--SGTA--------SN---VMIYL----A--KGDV---A-L-SVTI-SA-VSTL----------V--------GVFATPL---------LTRLYVDA---TISVDVV---G--MLKSILQIVVIPI-------------TAGLVI------H-HT--FTKT-VKRIEPYLPAMSMVC------ILAIISAVVAG--S-QSH-------IASVG----------------------------FVVI-----------------IAVI---------LH-N----GI----GLLSGYWGGKLF---------GFDESTCRTLAIEVG--------MQNSGLAA-----TLGKIYF---------------S--P--LAAL---P-----------------GALF----------------SVWHN-LSGSLLA------GYW---------SGKPVK-KDQE-------------------------------
1 PsiBlast_PDB 85.2425%-136 - C4 -4N7W ? A:[40-283] ---------------------------------------------------------------------------------------------------------------------------------------------------------LI---MFAMGVTLRL-------DD--------FKRVLSRPAPVAAATF-LHYLIMPLTA--WI--L----------A--------------ML---------------------------------FRM-----P--P--DLSAGMV---LVGS-V------A--SGTA--------SN---VMIYL----A--KGDV---A-L-SVTI-SA-VSTL----------V--------GVFATPL---------LTRLYVDA---TISVDVV---G--MLKSILQIVVIPI-------------TAGLVI------H-HT--FT-KTVKRIEPYLPAMSMVC------ILAIISAVVAG--S-QSH-------IASVGFV----------------------------VI-----------------IAVI---------LH-N----GI----GLLSGYWGGKLF---------GFDESTCRTLAIEVG--------MQNSGLAA-----TLGKIYF---------------S--P--LAAL---P--------------------G----------------ALFS---------------------------------------------------------------------
2 PsiBlast_PDB 83.5125%-145 - C4 -4N7X - ? A:[40-283] ---------------------------------------------------------------------------------------------------------------------------------------------------------LI---MFAMGVTLRL-------DD--------FKRVLSRPAPVAAATF-LHYLIMPLTA--WI--L----------A--------------ML---------------------------------FRM-----P--P--DLSAGMV---LVGS-V------A--SGTA--------SN---VMIYL----A--KGDV---A-L-SVTI-SA-VSTL----------V--------GVFATPL---------LTRLYVDA---TISVDVV---G--MLKSILQIVVIPI-------------TAGLVI------H-HT--FT-KTVKRIEPYLPAMSMVC------ILAIISAVVAG--S-QSH-------IASVGFV----------------------------VI-----------------IAVI---------LH-N----GI----GLLSGYWGGKLF---------GFDESTCRTLAIAVG--------MQNSGLAA-----TLGKIYF---------------S--P--LAAL---P--------------------G----------------ALFS---------------------------------------------------------------------
25 Fugue 80.9917%-151 * C4 *4CZB NAH1_METJA A:[1-415] -----------------------------------------------------------------------MELMMAIGYLGLALVLGSLVAKIAEKLKIPDIPLLL----LLGLII--GPFLQIIPSDSA-----MEIFEYA---GP-IGLIFI---LLGGAFTMRI-------SL--------LKRVIKTVVRLDTITF-LITLLISGFI--FN--MVLNLPYTSPVG-------------YLFGAITAATDPATLIPVFSRVRTNPEVAITLEAESIFN-----D--P--LGIVSTS---VILG-LFGLFSSS--NPLI--------DL---ITLAG----G--AIVV---G-L-LLAK-IY-EKII----------IHCDFHEYVAPLVLGG---------AMLLLYVG---DDLLPSI---CGYGFSGYMAVAIMGL-------------YLGDAL------F-RA--DDI-DYKYIVSFCDDLSLLA------RVFIFVFLGAC--IKLSM-------LENYFIPG-------------------------LLVA-----------------LGSI---------FL-A----RP----LGVFLGLIGSKH---------SFKEKLYFALEGPRG--------VVPAALAV-----TVGIEILKNADKIPASITKYITP--T--DIAG---T-----------------IIIG----------------TFMTI-LLSVILE------ASW---------AGMLAL-KLLGE------------------------------
23 Fugue 79.1516%-166 - C2 -4QHW ? A:[2-401] ----------------------------------------------------------------------------------------------------------Q----PQQVVV--GVSG-----NGY-----VTRQQDG---AR-ITQRGV---THWTNPKS-I-------VS--------IYFYLHQPTTADLSLY-AKGHSEIKVS--YGKKG----------F-------------KVN---------------------------------LQS-----N--D--FTKVPVG---SIDI-R------Q--AGYV--------RI---DLQGV----S--KSGE---G-FGEIKQ-LI-ADNV----------T--------GKSNYVK---------DFSDYWGRRGPSVHLGYALPEG--DTEWFYNEITVPKEGETMHSYYMAAGFGEGYF------GMQY--NSPTERRILFSVWSPFDTQN------PKEIP--DDQK--I-KLL-------RQGKDVHI-------------------------GEFGNEGSGGQSYLKYPWKAGNTYK---------FLMQ----IRPDGNGNTTYTAYFYAT---------DEKEWKLIASFLRPK--------TNTWYKRP-----HSFLENF---------------S--P--EQGYLSRE-----------------VFFGNQWARSKEGKWSRLTDATFTH-DATASAQ------VRLDYQGGNTKDNRFYLKMGGFFNESVPMGTKFYCKPTGKEPEIDWEALKQL--
26 Fugue 75.0615%-145 - C5 -5EZ7 ? A:[2-392] ------------------------------------------------------------------------------------------------------MPQAL----STDILIVGGGIA-----GLW-----LNARLRR---AG-YATVLVESASLGGGQSVKS-------QG--------IIHGGTGASEAIAD----MPRRWRACL--GS--D----------G-------------ELD---------------------------------LRG-----V--R--LLSEAHY---LWSP-V------E--QAKG--------ED---LPPALRDKGF--KGKA---Y-R-LTEI-VFDVPDL----------I--------RRLAELA---------GDSLLAGE---RIEPLRE---GR-ELAGLCVDGREIR-------------AQRVVL------S-AG--AGNEALLRELGLEQPAMQRR------PLHMVMVKAAT--L-KPL-------YAHCLGAG-------------------------PKPR-----------------ITVT---------TH-P----TR----DGQSVWYLGGDIAETDGVARDEAAQIAEARRELAKL--------LPWIDLGQ-----AQWATLR---------------V--D--RAEP---AQSNLLRPDNAFLAEQGRLLVGWPTK------------LALAP-DFADRVC------ARL---------EEDGIR-PSEHAALPQLPRPPLAEPAWEVAFA----------
28 Fugue 67.0117%-162 - C3 -4XGC ORC5_DROME E:[1-458] -------------------------------------------------------------------------------------------MEAICSSLEPLFPCRE----AAIETL--GELI-----GDS-----SETYPSA---IY-LFGHSG---TGKTALTRAFLKECGKRQN--------VRTAHLNAIECYTTKI-MLEILLDSLA--PD--Q----------GDALKVDNMLDFVEQLR---------------------------------RQA-----AT-R--VEDQGFL---IAVD-N------A--ERLR--------DMDANVLPVLLR--L--QELT---N-L-NLCV-IL-LSQLPFEKFYNKTGL--------SE-IVCL---------HLAQYNKA---ETQRILGS--D--FQQVRNQLLEQKK-------------RLEICQ------E-AV--TEDFYNNYLNLFLSVFYKACRDVPELQLTARKCLSTY--L-EPVLDGTSRLWRHIAGPL-------------------------RSAL-----------------TQIYMRIESLELPYY-A----KF----LLIAAFLASHNA---------AKQDKRLFST--TLG--------PKSFSIDR-----LLAIFYA---------------I--L--EEKV---G-----------------LTCN----------------LLSQI-STLVHLN------LLS---------FVSGEQ-NIMEGSARLQCTIGLEFVLQIGKVVGFNVRQYLCD
20 Fugue 66.6920%-146 * C5 *4A1N EXOG_HUMAN A:[19-311] ------------------------------------------------------------------------------------------------------KAVLEQFGFPLTGTE--ARCY-----TNH-----ALSYDQAKR-VPRWVLEHI---S--KSKIMGD-------AD--------RKHCKFKPDPNIPPTFSAFNEDYVGSG--WS--R----------G-------------HMA---------------------------------PAGNNKFSS--K--AMAETFY---LSNI-V------PQDFDNN--------SG---YWNRI----E--MYCR---E-L-TERF-ED-VWVV----------S--------GPLTLPQ---------T-RGDGKK---IVSYQVI---G--EDN-----VAVPS-------------HLYKVI------L-AR--RSSVST----------EPLA------LGAFVVPN------------------EAIGFQP-------------------------QLTE-----------------FQVS---------LQ-D----LE----KLSGLVFFPHL-----------DRTSDIRNICSVDT--------CKLLD--------FQEFTLY---------------L--S--TRKI---E-----------------GSV-----------------LRLEK-IMVNLKNEIEPDDYFM---------SRYEKK-L----------------------------------
4 PsiBlast_PDB 66.1526%-133 - C4 -3ZUY ? A:[31-190] -----------------------------------------------------------------------------------------------------------------------------------------DTFKWAGPYIP-WLLGII---MFGMGLTLKP-------SD--------FDILFKHPKVVIIGVI-AQFAIMPATA--WL--L----------S-------------KLL---------------------------------NLP-----A--E--IAV-GVI---LVGC-C------P--GGTA--------SN---VMTYL----A--RGNV---A-L-SVAV-TS-VSTL----------I--------SPLLTPA---------IFLMLAGE---MLEIQAA---G--MLMSIVKMVLLPI-------------VLGLIV------H-KVLGSKTEK------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 65.1726%-126 - C4 -3ZUX ? A:[36-195] -----------------------------------------------------------------------------------------------------------------------------------------DTFKWAGPYIP-WLLGII---MFGMGLTLKP-------SD--------FDILFKHPKVVIIGVI-AQFAIMPATA--WC--L----------S-------------KLL---------------------------------NLP-----A--E--IAV-GVI---LVGC-C------P--GGTA--------SN---VMTYL----A--RGNV---A-L-SVAV-TS-VSTL----------T--------SPLLTPA---------IFLMLAGE---MLEIQAA---G--MLMSIVKMVLLPI-------------VLGLIV------H-KVLGSKTEK------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 Fugue 57.6010%-144 * C6 *1PMM DCEB_ECOLI A:[3-452] KKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWH----APAPKN--GQAV-----GTN-----TIGSSEA---CM-LGGMAM---KWRWRKRMEA-------AGKPTDKPNLVCGPVQICWHKFARYW-DVELREIPMR--PG--Q----------L-------------FMD---------------------------------PKR-----M--I--EACDENT---IGVV-P------T--FGVTYTGNYEFPQP---LHDAL----D--KFQA---D-T-GIDIDMH-IDAA----------S--------GGFLAPFVAPDIVWDFRLPRVKSI---SASGHKF---G--LAPLGCGWVIWRD-------------EEALPQ------E-LV--FNVDYLGGQIGTFAINFSRP------AGQVIAQYYEF--L-RLG-------REGYTKVQ-------------------------NASY-----------------QVAA---------YL-A----DE----IAKLGPYEFICT---------GRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTL---------------G--G--EATD---I-----------------VVMR----------------IMCRRGFEMDFAE------LLL---------EDYKAS-LKYLSDHP---------------------------
27 Fugue 55.6910%-160 - C6 -1NIJ - YJIA_ECOLI A:[2-318] -----------------------------------------------------------------------------------------------------------------NPIA--VTLL-----TGF-----LG--------------------------AGKT-------TL--------LRHILNEQHGYKIAVI-EN----EFGE--VS--V----------D-------------DQL---------------------------------IGD-----R--A--TQIKTLTNGCICCS-R------S--NELE--------DA---LLDLL----D--NLDK---GNI-QFDR-LV-IECT----------G--------MADPGPI---------IQTFFSHE---VLCQR-----Y--LLDGVIALVDAVH-------------ADEQMNQFTIAQS-QV--GYADRILLTKTDVAGEAEKL------HERLARINARAPVY-TVT-------HGDIDLGLLFNTNGFMLEENVVSTKPRFHFIADKQND-----------------ISSI---------VV-ELDYPVD----ISEVSRVMENLL---------LESADKLLRYKGMLW--------IDGEPNRL-----LFQGVQR---------------L--Y--SADW---D-----------------RPWG----------------DEKPH-STMVFIG------IQL---------PEEEIR-AAFAGLRK---------------------------
21 Fugue 50.7412%-114 - C1 -3A1Y - RL10_PYRHO G:[1-284] ------------------------------------------------------------------------------------------------------MAHVA----EWKKKE--VEEL-----AKL-----IKSYP---------VIALV---DVSSMPAYPL-------SQ--------MRRLIRE-----------------------N--G----------G-------------LLR---------------------------------VSR-----N--T--LIELAIK---KAAK-E------L--GKPE--------LE---KLVEY----I--DRGA---G-I-LVT---------------------------------------------------------NMNPF---K--LYKFLQQ-------------------------------N-RQ--PQPLEVGLDVLAVYEDGIVY------TPDVLAIDEQE--Y-IDM-------LQKAYMHA-------------------------FNLA-----------------VNIA---------YP-T----PE----TIEAIIQKAFLN---------AKTVAIEAGY------------------------------------------------I--T--KETI---Q-----------------DIIG----------------RAFRA-MLLLAQQ------LP----------------------------------------------------
8 PsiBlast_PDB 41.3332%-103 - C4 -2OOL - ? A:[56-114] -----------------------------------------------------------------------------------------------------------------------------------------------------------------ASVSANV-------ED--------L---LRQPPASLLNVP-IAHYLTAASA--AR--L----------T-------------HAL---------------------------------HG-------------AINPIR---LDVV-T------P--DG--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 HHSearch 41.0611%-121 - C4 -4CZ8 ? A:[35-174] ---------------------------------------------------------------------------------------------------------FI----LTGLVI--GPLL-----KLIPRDLAHEIFDFV---RV-FGLVII---LFTEGHNLSW-------RL--------LKKNM---PTIVTLDT-IGL-ILTALIAGFI--F----------K-------------VV----------------------------------FNS-----SFLL--GFLFGAI---IGAT-D------P--ATLI---------P---LFRQY----RVKQDIE---T-V-IVTE-SI-FNDP----------L--------GIVLTLI---------AISMLV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 40.6932% -95 - C4 -4R70 - ? A:[57-114] ------------------------------------------------------------------------------------------------------------------------------------------------------------------SVSANV-------ED--------L---LRQPPASLLNVP-IAHYLTAASA--AR--L----------T-------------HAL---------------------------------HGG-----D--P--AAINPIR---LDVV-T------P--DG--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 HHSearch 39.4112%-100 - C4 -5BZ3 ? A:[34-171] ---------------------------------------------------------------------------------------------------------EV----LAGVLV--GPAL-----LGLVHE--GEILEFL---AE-LGAVFL---LFMVGLETRL-------KD--------ILAVGKEA--FLVAV--LGVALPFLGG--YL--Y----------G-------------LE----------------------------------IGF-----E--TLPALFLGTA---LVAT-S------V--GITA---------R---VLQEL----G--VLSRPYSR-I-ILGA-AV-IDDV----------L--------GLIVLAC---------VNGVAE-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 38.6031% -77 - C4 -3TQI - GUAA_COXBU A:[193-305] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILAHF-VIHICQCIPN--WT--T----------K-------------HII---------------------------------EDSIR---D--I--QEKVGKE---QVIVGL------S--GGVD--------SA---VTATL----V--HKAI---G-D-QLVC-VL-VDTG----------L-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------