@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu01610: (2016-06-03 )
MKIYGIYMDRPLSQEETDRLMSFVSAEKREKCRRFYHKEDAHRTLLGDVLVRSVISEQYQLNKADIRFSAQEYGKPCIPDLPNAHFNISHSGHWVIGAFDSDPIGVDIEKMKPISLGIAERFFSKNEYSDLLSKHKDEQNDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHEDGRVSVELPEHHTPCFIKTYEVDPGYKMAVCAARPDFPEDITMISYEALL

Atome Classification :

(20 SA) ------.........10.---.......20........30........40........50........60--.........70.......-----.80----.-........90........-100---.-.....-..-----110-------..-----.-------.------...120.......130.-..-...--.140.......150......--.160.--...--....170...-----..---------..180..---------.---------....190........200.......210.......220..------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------MKIYGIYMDRPL---SQEETDRLMSFVSAEKREKCRRFYHKEDAHRTLLGDVLVRSVISEQYQ---LNKADIRFSAQEYGKPCI-----PD-----L-PNAHFNISHSGHWVIGAF-DS----D-PIGVD-IE-----KMK-------PI-----S-------L------GIAERFFSKNEYSDLLS-KH-KDE--QNDYFYHLWSMKESFIKQEG--KGL-S--LPL--DSFSVRLHED-----GR---------VSVELPE---------H---------HTPCFI-KTYEVDPGYKMAVCAARPDFPEDITMISYEALL------------------------------
2 PsiBlast_PDB 99.5386%-122 - C4 -4MRT SFP_BACSU A:[1-224] ------MKIYGIYMDRPL---SQEENERFMTFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQ---LDKSDIRFSTQEYGKPCI-----PD-----L-PDAHFNISHSGRWVIGAF-DS----Q-PIGID-IE-----KTK-------PI-----S-------L------EIAKRFFSKTEYSDLLA-KD-KDE--QTDYFYHLWSMKESFIKQEG--KGL-S--LPL--DSFSVRLHQD-----GQ---------VSIELPD---------S---------HSPCYI-KTYEVDPGYKMAVCAAHPDFPEDITMVSYEELL------------------------------
39 Fugue 97.5586%-126 - C4 -1QR0 SFP_BACSU A:[1-228] ------MKIYGIYMDRPL---SQEENERFMTFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQ---LDKSDIRFSTQEYGKPCI-----PD-----L-PDAHFNISHSGRWVIGAF-DS----Q-PIGID-IE-----KTK-------PI-----S-------L------EIAKRFFSKTEYSDLLA-KD-KDE--QTDYFYHLWSMKESFIKQEG--KGL-S--LPL--DSFSVRLHQD-----GQ---------VSIELPD---------S---------HSPCYI-KTYEVDPGYKMAVCAAHPDFPEDITMVSYEELLRAAA--------------------------
14 HHSearch 97.0286%-126 - C4 -1QR0 SFP_BACSU A:[1-223] ------MKIYGIYMDRPL---SQEENERFMTFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQ---LDKSDIRFSTQEYGKPCI-----PD-----L-PDAHFNISHSGRWVIGAF-DS----Q-PIGID-IE-----KTK-------PI-----S-------L------EIAKRFFSKTEYSDLLA-KD-KDE--QTDYFYHLWSMKESFIKQEG--KGL-S--LPL--DSFSVRLHQD-----GQ---------VSIELPD---------S---------HSPCYI-KTYEVDPGYKMAVCAAHPDFPEDITMVSYEEL-------------------------------
1 PsiBlast_PDB 96.9086%-126 - C4 -1QR0 SFP_BACSU A:[1-224] ------MKIYGIYMDRPL---SQEENERFMTFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQ---LDKSDIRFSTQEYGKPCI-----PD-----L-PDAHFNISHSGRWVIGAF-DS----Q-PIGID-IE-----KTK-------PI-----S-------L------EIAKRFFSKTEYSDLLA-KD-KDE--QTDYFYHLWSMKESFIKQEG--KGL-S--LPL--DSFSVRLHQD-----GQ---------VSIELPD---------S---------HSPCYI-KTYEVDPGYKMAVCAAHPDFPEDITMVSYEELL------------------------------
40 Fugue 66.5525% -98 - C4 -2BYD ADPPT_HUMAN A:[18-318] LYFQGHMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLN---IPWNHIRLQRTAKGKPVLAKDSSNP-----Y-PNFNFNISHQGDYAVLAAEPE----L-QVGID-IM-----KTS-------FP-----GRGSIPEFF------HIMKRKFTNKEWETIRSFKD-EWT--QLDMFYRNWALKESFIKAIG--VGL-G--FEL--QRLEFDLSPL-----NLDIGQVYKETRLFLDGE---------E---------EKEWAF-EESKIDEHHFVAVALRKQ---RQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTK
41 Fugue 55.8684% -82 - C4 -1QR0 SFP_BACSU A:[105-211] -------------------------------------------------------------------------------------------------------------------------------------GID-IEKTKPIS------------------------L------EIAKRFFSKTEYSDLLAKD--KDE--QTDYFYHLWSMKESFIKQEG--KG-LS--LPL--DSFSVRLHQD-----GQ---------VSIELPDS------------------HSPCYI-KTYEVDPGYKMAVCAAHPDF-------------------------------------------
3 PsiBlast_PDB 55.6931% -76 - C4 -2BYD ADPPT_HUMAN A:[50-230] --------------------------------IQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLN---IPWNHIRLQRTAKGKPVL-----AKDSSNPY-PNFNFNISHQGDYAVLAA-EP----ELQVGID-IM-----KTSFPGRGSIPE-----F-------F------HIMKRKFTNKEWETIRS--F-KDEWTQLDMFYRNWALKESFIKAIG--VGL-G--FEL--QRLEFDL-------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 54.9331% -73 - C4 -2CG5 ADPPT_HUMAN A:[50-228] --------------------------------IQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLN---IPWNHIRLQRTAKGKPVL-----AKDSSNPY-PNFNFNISHQGDYAVLAA-EP----ELQVGID-IM-----KTSFPGRGSIPE-----F-------F------HIMKRKFTNKEWETIRS--F-KDEWTQLDMFYRNWALKESFIKAIG--VGL-G--FEL--QRLEFDL-------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 54.2231% -78 - C4 -2C43 ADPPT_HUMAN A:[50-228] --------------------------------IQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLN---IPWNHIRLQRTAKGKPVL-----AKDNP--Y-PNFNFNISHQGDYAVLAA-EP----ELQVGID-IM-----KTSFPGRGSIPE-----F-------F------HIMKRKFTNKEWETIRS--F-KDEWTQLDMFYRNWALKESFIKAIG--VGL-G--FEL--QRLEFDL-------------------------------------------------------------------------------------------------------------------
16 HHSearch 45.6714% -54 - C4 -4U89 ? A:[49-247] ----------------------------PGLTPLPEEAPLIARS-VAKRRNEFITVRHCARIALDQ-LG---VP--PAPILKGDKGEPCW-----PD--------GMVGSLTHCAGYRGAVV-GRRDAVR-SVGID-AE-----PHD-------VL-----P-------N------GVLDAISLPAERADMPR-TM--PA--ALHWDRILFCAKEATYKAWFPLTKR-W--LGF--EDAHITFETDSTGWTGR---------FVSRILI---------DGSTLSG---PPLTTLRGRWSVERGLVLTAIVL-----------------------------------------------
17 HHSearch 43.0214% -42 - C4 -4QVH MALE_ECOLI A:[398-553] --------------------------DPPGLTPLPEEAPLIARSV-AKRRNEFITVRHCARIALDQL-G---VP--PAPILKGDKGEPCW-----PD--------GMVGSLTHCAGYRGAVV-GRRDAVR-SVGID-AE-----PHD-------VL-----P-------N------GVLDAISLPAERADMPR-TM--PA--ALHWDRILFCAKEATYKAWFPLTKR-W--LGF--EDAHITFET-----------------------------------------------------------------------------------------------------------------
22 HHSearch 42.2921% -48 - C4 -1F7L ACPS_BACSU A:[3-117] ---------------------------------------------------------------------------------------------------------------------------------Y-GIGLD-IT-----ELK-------RI-----ASMAGRQ-K------RFAERILTRSELDQYYE-LS-EKR--KNEFLAGRFAAKEAFSKAFG--TGI-G--RQLSFQDIEIRKDQN-----GK---------PYIICTKL--------S---------PAAVH--VSITHTKEYAAAQVVIE----------------------------------------------
31 HHSearch 42.0222% -72 - C4 -5CXD ACPS_STAAC A:[27-116] --------------------------KLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGHVAFNDIDCYNDELGKPKI-----DY-----EGFIVHVSISHTEHYAMSQV-V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 HHSearch 41.7418% -58 - C4 -3HYK ACPS_BACAN A:[6-119] ---------------------------------------------------------------------------------------------------------------------------------V-GIGID-II-----ELN-------RIEKMLD---------------KFMERILTENERNVAKG-LK-GSR--LTEFVAGRFAAKEAYSKAVG--TGI-G--KEVSFLDIEVRNDDR-----GK---------PILIT-----------S---------TEHIVH-LSISHSKEFAVAQVVLES---------------------------------------------
29 HHSearch 41.3620% -67 - C4 -5CXD ACPS_STAAC A:[5-119] ----------------------------------------------------------------------------------------------------------------------------I----H-GIGVD-LI-----EID-------RI-----QALYSKQ-P------KLVERILTKNEQHKFNN-FTHEQR--KIEFLAGRFATKEAFSKALG--TG---H-VAF--NDIDCYNDEL-----GK---------PKID--Y---------E---------GFIVHV--SISHTEHYAMSQVVLEK---------------------------------------------
34 HHSearch 41.1122% -74 - C4 -4JM7 - ACPS_STAAC A:[25-113] ---------------------------LVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALG---VAFNDIDCYND--GKPKI-----DY-----EGFIVHVSISHTEHYAMSQV-V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 HHSearch 40.7118% -47 - C4 -5CMO - ACPS_NEIMF A:[3-123] ---------------------------------------------------------------------------------------------------------------------------------Y-GIGTD-IV-----SLK-------RI-----IRLNKKFGQ------AFAGRILTPEELLEFPQ-A---GK--PVNYLAKRFAAKEAFAKAVG--TGI-RGAVSF--RNIGIGHDAL-----GK---------PEFFYGPALSKWLEEQG---------ISRV-S-LSMSDEEDTVLAFVVA-----------------------------------------------
42 Fugue 39.8517% -42 * C4 *1F7L ACPS_BACSU A:[1-118] ---------------------------------------------------------------------------------------------------------------------GIYGI-GL----D-ITELKRIA-----SMA-------GR-----Q-------K------RFAERILTRSELDQYYE-LS-EKR--KNEFLAGRFAAKEAFSKAFG--TGI-G--RQL--SFQDIEIRKDQN---GK---------PYIICTK---------L---------SPAAVH-VSITHTKEYAAAQVVIER---------------------------------------------
20 HHSearch 39.7023% -42 - C4 -2WAS - FAS2_YEAST A:[1767-1885] ---------------------------------------------------------------------------------------------------------------------------------G-GVGVD-VE-----LIT-------SI-----NVEN----D------TFIERNFTPQEIEYCSA-Q---PS--VQSSFAGTWSAKEAVFKSLG--V-------AL--KDIEIVRVNK-----NA---------PAVELHG---------NAKKAAEEAGVTDVK--VSISHDDLQAVAVAVST----------------------------------------------
11 PsiBlast_PDB 39.7024% -35 - C4 -1F80 - ACPS_BACSU A:[4-85] ------------------------------------------------------------------------------------------------------------------------------------IGLD-IT-----ELK-------RI-----A-------SMAGRQKRFAERILTRSELDQYYE-LS-EAR--KNEFLAGRFAAKEAFSKAFG--TGI-GRQLSF--QDIEIRKDQN-----GK---------------------------------------------------------------------------------------------------------