@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu01950: (2016-06-03 )
MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTTIRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHPGKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGLDIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQAEWRKEVIRLLGEWSDE

Atome Classification :

(21 SA) -.........10...--.-----.--.-----.-.--20.---.......30........40........50........60....----------.-----...-----70-..------..---.-....80..--......90.......-.100..-----.....110.......120-.-......130.......140.......150.......160..-.....170....-.-..180-........190.......200.......-210-----...-.-...220.......230.......-------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MQLMQVQNLSKCYR--N-----G--D-----G-V--EHL---SFSIQRGEIVALLGPNGAGKTTTIRCLTGLYKPDKGDILIEGS----------P-----PGD-----I--NV------QK---K-VALIPDQP--YLYPALTAAEHIQFR-ARGYHP-----GKKDVKERVYHALKEVHL-E-EKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGLD-IPSKQWLSNWLK-T-KTD-Q-GCSAFVSTHSLEFVIETADRVILIRDGK-LMQ-----DLY-V-PQFEEQAEWRKEVIRLLGEWSDE-------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 89.9431% -88 - C1 -1OXV ? A:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 88.4131% -92 - C1 -1OXU ? B:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 87.5731% -93 - C1 -1OXU ? C:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 87.4131% -92 - C1 -1OXS ? C:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 87.1531% -92 - C1 -1OXV ? B:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
51 Fugue 86.9231% -99 - C1 -1Z47 ? A:[11-355] GSMTIEFVGVEKIYP--G-----G--A-----RSV--RGV---SFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK----------R-----VTD-----L--PP------QK---RNVGLVFQNY--ALFQHMTVYDNVSFG-LREKRV-----PKDEMDARVRELLRFMRL-E-SYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAID-TQIRRELRTFVR-Q-VHD-EMGVTSVFVTHDQEEALEVADRVLVLHEGN-VEQ-----FGT-P-EEVYEKPG-TLFVASFIGESNVWTRAVQNGRIEVAGAALPVDPAVSEGSEVAVVVRPKDVELQPASEREAHAQVVRSAFKGSYSACWIRTKDGEVWEVHVPSADRHRWSPGAWVHMNVTRWFIFPR
24 PsiBlast_CBE 86.8831% -90 - C1 -1OXV ? D:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 86.4631% -91 - C1 -1OXT - ? A:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 85.9731% -91 - C1 -1OXU ? A:[1-254] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLYDN-PVSIQVASLIGEINELEGKVTNE-------------------------------------------------------------------------------------------------------
50 Fugue 84.0932% -84 - C1 -1OXS ? C:[1-352] -MVRIIVKNVSKVFK--K-----GKVV-----A-L--DNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR----------L-----VAS-----N--GKLIVPPEDR---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVK-EVQSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLY-DNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK-----
46 HHSearch 84.0134% -90 - C1 -4MKI ECFA2_CALS4 B:[5-233] --MPIKVENVSFIYN--EGTPYAT--V-----A-L--KDI---NFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGKIYINGI----------D-----ITDKKVSLK--DI------RK---Q-VGLVFQYPEYQLFE-ETVFKDIAFG-PSNLGL-----SEEEVKERVYEAMEIVGI-SKELADKSPFELSGGQKRRVAIAGILAMRPKILILDEPTAGLD-PKGKQEILNKIK-E-IHDKY-KMITILVSHNMEDIARIADKIIVMNRGK-IEL-----IGT-P-R-----------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 80.6233%-103 - C1 -1Z47 ? B:[15-226] ----IEFVGVEKIYP--G-----GA-R-----S-V--RGV---SFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK----------R-----VTD-----L--PP------QK---RNVGLVFQNY--ALFQHMTVYDNVSFG-LREKRV-----PKDEMDARVRELLRFMRL-E-SYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAID-TQIRRELRTFVR-Q-VHD-EMGVTSVFVTHDQEEALEVADRVLVLHEGN-VEQ-----------------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 79.8332% -96 - C1 -1OXX ? K:[1-229] -MVRIIVKNVSKVFK--K-----G--K-----V-VALDNV---NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVP-----PED-----------------R---K-IGMVFQTW--ALYPNLTAFENIAFP-LTNMKM-----SKEEIRKRVEEVAKILDI-H-HVLNHFPRELSGAQQQRVALARALVKDPSLLLLDEPFSNLD-ARMRDSARALVKEV-QSR-L-GVTLLVVSHDPADIFAIADRVGVLVKGK-LVQVGKPEDLY---------------------------------------------------------------------------------------------------------------------------------
20 PsiBlast_PDB 78.3628% -99 - C1 -3GFO ECFA3_CLOP1 A:[7-245] ---ILKVEELNYNYS--D-----G--TH----A-L--KGI---NMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNK----------PIDYSRKGI-----M--KL------RE---S-IGIVFQDPDNQLFSA-SVYQDVSFG-AVNMKL-----PEDEIRKRVDNALKRTGI-E-HLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVE-M-QKE-L-GITIIIATHDIDIVPLYCDNVFVMKEGRVILQ-----GNP-K-EVFAEKEVIRKVNLRL--------------------------------------------------------------------------------------------------------------
44 HHSearch 75.8832% -97 - C1 -4RVC - ? A:[2-225] --TLLEVKDLSGGYT--A-----Q--N-----V-L--EDV---TFVVDRGEMVALIGLNGAGKSTTIKHIIGLMEPRRGAISINGY----------R-----LAD-----GPETY------RR---Q-FAYIPETP--VLYEELTLEEHLRLA-AMAYGL-----SEAEYERRLPPLLREFRL-E-RRLSSFPAHFSKGMKQKVMIVCAFLLEPPLYIIDEPFLGLD-PLAIHALLERMN-E-QKA-K-GAGILLSTHILATAERYCDSFVILHNGR-VKA-----KGT-L-DDIRRQF-----------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 75.7233% -99 - C1 -1Z47 ? A:[15-226] ----IEFVGVEKIYP--G-----GA-R-----S-V--RGV---SFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK----------R-----VTD-----L--PP------QK---RNVGLVFQNY--ALFQHMTVYDNVSFG-LREKRV-----PKDEMDARVRELLRFMRL-E-SYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAID-TQIRRELRTFVR-Q-VHD-EMGVTSVFVTHDQEEALEVADRVLVLHEGN-VEQ-----------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 75.5633% -93 - C1 -4MKI ECFA2_CALS4 B:[7-226] ----IKVENVSFIYN--E-----G--TPYATVA-L--KDI---NFSIDDEEFVGIIGHTGSGKSTLIQQLNGLLKPSKGKIYINGI----------D-----ITDKKVSLK--DI------RK---Q-VGLV------FQYPEYQLFEETVFK-DIAFGPSNLGLSEEEVKERVYEAMEIVGISK-ELADKSPFELSGGQKRRVAIAGILAMRPKILILDEPTAGLD-PKGKQEILNKIK-E-IHD-KYKMITILVSHNMEDIARIADKIIVMNRGK-I-------------------------------------------------------------------------------------------------------------------------------------------