@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu02480: (2016-06-04 )
MKRSISIFITCLLIAVLTMGGLLPSPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKNISWVNWNLSDKQESSSALKPGASKTGGWPLTDLTASGTFVRENIRGTKDSTKDVPETPAQDNPTQEKGVSVQYKAGDGRVNSNQIRPQLHIKNNGNATVDLKDVTARYWYNVKNKGQNFDCDYAQMGCGNLTHKFVTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTFKTTKKITLYHQGKLIWGTEPN

Atome Classification :

(31 SA) .........10........20........30........40........50........60.......--.70-........80........90.....--...100...--.-...-..110.......120.......130.......140........150.......160--........170---------..-.-......180.......190.......200.......210.......-220.......230......---------------.240.......250.......260.......270.......280.......290.......300-------------.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKRSISIFITCLLIAVLTMGGLLPSPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-DFVNKDSLKWLRDDWGITVFRAAMY--TADG--GYI--D-NPS-VKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQS---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKNISWVNWNLSDKQESSSA-------------LKPGASKTGGWPLTDLTASGTFVRENIRGTKDSTKDVPETPAQDNPTQEKGVSVQYKAGDGRVNSNQIRPQLHIKNNGNATVDLKDVTARYWYNVKNKGQNFDCDYAQMGCGNLTHKFVTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTFKTTKKITLYHQGKLIWGTEPN
2 PsiBlast_PDB 82.9395% -65 - C1 -3PZU GUN2_BACSU A:[30-326] ----------------------------------PVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--TADG--GYI--D-NPS-VKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 82.5695% -68 - C1 -3PZT GUN2_BACSU A:[34-326] --------------------------------------NGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--TADG--GYI--D-NPS-VKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 82.3995% -68 - C1 -3PZT GUN2_BACSU B:[31-326] -----------------------------------VAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--TADG--GYI--D-NPS-VKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 81.8595% -61 - C1 -3PZV - GUN2_BACSU A:[34-331] ---------------------------------TPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--TADG--GYI--D-NPS-VKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 81.0395% -64 - C1 -3PZU GUN2_BACSU B:[30-326] ----------------------------------PVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--TADG--GYI--D-NPS-VKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 79.0070% -76 - C1 -1HF6 GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 78.9570% -75 - C1 -1W3K GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 78.8970% -76 - C1 -1H2J GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 PsiBlast_PDB 78.7170% -77 - C1 -1QHZ GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 78.7170% -76 - C1 -1H5V GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 78.6570% -76 - C1 -8A3H GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 78.6470% -74 - C1 -1H11 GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 78.5870% -77 - C1 -4A3H GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 78.5170% -75 - C1 -7A3H GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 78.4470% -77 - C1 -6A3H GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 78.4370% -72 - C1 -4XZW ? A:[3-302] --------------------------------KTPVAKNGQLQVVGTALLNRDGKPFQLRGISTHGLQ--WFG-QFANKDAFQTLRDDWKANVVRLAMY--TDPNANGYI--A-QPEWLKAKVKEGVEAAKELGMYVIIDWHILNDNDPNLY-KEQAKRFFAEMAREYGNTPN---VIYEIANEP-----------NG-D-VTWEEKIRPYADEVIRTIRSIDRDNLIIVGTGTWSQDVDDVASDPL-PYKNIMYALHFYAGTHGQF---------------LRDKANYALSKGTPIFVTEWGTSDASGDGGVFLDQSREWLKYLDSKTISWVNWSLCDKNEASAA-------------LRPGADPHGGWGDDHLSDSGRFIKAKL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 78.3870% -78 - C1 -1E5J GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 78.3370% -76 - C1 -2A3H GUN5_BACAG A:[3-298] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 78.2370% -76 - C1 -1W3L GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
79 HHSearch 78.2270% -76 - C1 -7A3H GUN5_BACAG A:[5-301] ----------------------------------VVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NG-SDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 78.2070% -77 - C1 -1OCQ GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 77.7770% -76 - C1 -2V38 GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--TSSG--GYI--D-DPS-VKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------