@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu02840: (2016-06-04 )
MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGADVIWICPIYPSPNVDYGYDVTNHKAIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHTSVEHPWFKEAELDKNSKYRSYYYWRPGTKNGPPTDWLSNYGCPVWQYEEHTGEYYLHMNAVKQADLNWENPEVRQAVYDMMKFWLDKGVDGLRIDQLHLISKKEYLPSYEDYINQQAEPKPFQPNGERIHDYLKEITDEVFSHYDVMSVGEVGSVTPEEGLKYTGTDKHELNMIFHFQHMELDQQPGKEHWDLKPLELSDLKSVLTKWQKKLEHQGWNTLFWCNHDQPRIVSRFGDDGEYRKASAKMLAAVIYFMKGTPYIYQGEEIGMTNAPFTRIEDYKDIQTINMYHKRVFEKGYDPNDVMRSILAKSRDHARTPMQWNSGKNAGFTDGTPWLKVNPNFTAINVEEAQGDPDSVLNYYKKLISLRKQYADLMKGSFDLLLPDDPQLFVYMRENSKQQLLSVNNFSKEQAVFQWPKNCGKAQASLLLSNYNNDDLDDEMVFRPYESRVYLLDKTN

Atome Classification :

(66 SA) .........10........20........30........40........50........60-........70........80........90........100.......110.-......120......--.-130------.-..-....140.......150.......160.......170.......180.-......-190.......200.------......210--------..--..------------..-.220--.......--------..230.......----240.......250.......260.-......270.......280.......290-...--..-...300.......310....-.-.-.320.......330.......340-.......350.......360.......370....--...380.......390.......-400.....---..410-.......420.......-430.-.--.....440.....-..450.......460.......470......-.480......--.490.......500.......510.......520...--..--.-.530....-.---.-.-540---.-.---.-..-...550.......560
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGADVIWICPIYPSPNVDY-GYDVTNHKAIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHTSVEHPWFKE-AELDKNSKYRSYYYW--R-PGT------K-NG-PPTDWLSNYGCPVWQYEEHTGEYYLHMNAVKQADLNWENPEVRQAVYD-MMKFWL-DKGVDGLRIDQLHL------ISKKEYLPS--------YE--DY------------IN-QQ----AEPKPFQ--------PNGERIHDYLKE----ITDEVFSHYDVMSVGEVGSVTPEE-GLKYTGTDKHELNMIFHFQHMELDQQPG--KEH--WD-LKPLELSDLKSVLTKWQKKL-E-H-QGWNTLFWCNHDQPRIVSRFGDDG-EYRKASAKMLAAVIYFMKGTPYIYQGEEIGMTNA--PFTRIEDYKDIQTINMYHKRVFE-KGYDPNDV---MRSIL-AKSRDHARTPMQWNSGK-NAGF-T--DGTPWLKVNPNFT-AINVEEAQGDPDSVLNYYKKLISLRKQYADL-MKGSFDLLLP--DDPQLFVYMRENSKQQLLSVNNFSKEQAVFQWPKNCG--KA--Q-ASLLLSNY-N---N-D-DL----D-D---E-MV-FRPYESRVYLLDKTN
105 HHSearch 73.2149% -63 - C1 -5BRQ ? A:[12-566] --NPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------PNGA-PPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFRLDVINV------ISKDQRFPD--------DD--E----------------------GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKADYPN---GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMYRIL-KE-AGKPEAEI---IEILK-AKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEF-DIITTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGY--D-AKVLISND-T---DLP-ES----F-K---R-FT-VKPYQSIVYHLAK--
103 HHSearch 72.8954% -59 - C1 -1UOK - O16G_BACCE A:[1-557] MEKQWWKESVVYQIYPRSFMDSNGDGIGDLRGIISKLDYLKELGIDVIWLSPVYESPNDDN-GYDISDYCKIMNEFGTMEDWDELLHEMHERNMKLMMDLVVNHTSDEHNWFIE-SRKSKDNKYRDYYIW--R-PGK------E-GK-EPNNWGAAFSGSAWQYDEMTDEYYLHLFSKKQPDLNWDNEKVRQDVYE-MMKFWL-EKGIDGFRMDVINF------ISKEEGLPT--------VE--TE------------EE-GY----VSGHKHF--------MNGPNIHKYLHE----MNEEVLSHYDIMTVGEMPGVTTEE-AKLYTGEERKELQMVFQFEHMDLDS-GE--GGK--WD-VKPCSLLTLKENLTKWQKAL-E-H-TGWNSLYWNNHDQPRVVSRFGNDG-MYRIESAKMLATVLHMMKGTPYIYQGEEIGMTNV--RFESIDEYRDIETLNMYKEKVME-RGEDIEKV---MQSIY-IKGRDNARTPMQWDDQN-HAGF-T--TGEPWITVNPNYK-EINVKQAIQNKDSIFYYYKKLIELRKNN-EIVVYGSYDLILE--NNPSIFAYVRTYGVEKLLVIANFTAEECIFELPEDIS--YS--E-VELLIHNY-D---V-ENGP----I-E---N-IT-LRPYEAMVFKL----
2 PsiBlast_PDB 72.6248% -66 - C1 -5BRQ ? A:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFRLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
22 PsiBlast_CBE 72.5848% -63 - C1 -5BRQ ? C:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFRLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
23 PsiBlast_CBE 72.1648% -65 - C1 -5BRQ ? B:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFRLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
1 PsiBlast_PDB 72.0853% -59 - C1 -1UOK - O16G_BACCE A:[1-557] MEKQWWKESVVYQIYPRSFMDSNGDGIGDLRGIISKLDYLKELGIDVIWLSPVYESPNDDN-GYDISDYCKIMNEFGTMEDWDELLHEMHERNMKLMMDLVVNHTSDEHNWFIE-SRKSKDNKYRDYYIW--R-PGK------E-GK-EPNNWGAAFSGSAWQYDEMTDEYYLHLFSKKQPDLNWDNEKVRQDVYE-MMKFWL-EKGIDGFRMDVINF------ISKEEGLPT--------VE--TE------------EE-GY----VSGHKHF--------MNGPNIHKYLHE----MNEEVLSHYDIMTVGEMPGVTTEE-AKLYTGEERKELQMVFQFEHMDLDSGEG--GK---WD-VKPCSLLTLKENLTKWQKAL-E-H-TGWNSLYWNNHDQPRVVSRFGNDG-MYRIESAKMLATVLHMMKGTPYIYQGEEIGMTNV--RFESIDEYRDIETLNMYKEKVME-RGEDIEKV---MQSIY-IKGRDNARTPMQWDDQN-HAGF-T--TGEPWITVNPNYK-EINVKQAIQNKDSIFYYYKKLIELRKNNEIV-VYGSYDLILE--NNPSIFAYVRTYGVEKLLVIANFTAEECIFELPEDIS--YS--E-VELLIHNY-D---V-E-NG----P-I---ENIT-LRPYEAMVFKL----
3 PsiBlast_PDB 72.0348% -64 - C1 -5BRP ? A:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFQLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
21 PsiBlast_CBE 71.9248% -65 - C1 -5BRQ ? D:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFRLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
25 PsiBlast_CBE 71.2048% -65 - C1 -5BRP ? C:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFQLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
24 PsiBlast_CBE 70.9148% -64 - C1 -5BRP ? D:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFQLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
107 HHSearch 70.2748% -55 - C1 -4MB1 O16G1_BACSU A:[3-560] ---EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDN-GYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAE-SRKSKDNPYRDYYLW--K-DPK------PDGS-EPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYD-VMRFWM-DRGVDGWRMDVIPS------ISKYTDFPD--------YE--TD------------HS-RS----YIVGRYH--------SNGPRLHEFIQE----MNREVLSHYDCMTVGEANGSDIEE-AKKYTDASRQELNMIFTFEHMDIDKEQNSPNGK--WQ-IKPFDLIALKKTMTRWQTGL-M-N-VGWNTLYFENHDQPRVISRWGNDR-KLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNS--D-MPLEMYDDLEIKNAYRELVVENKTMSEKEF---VKAVM-IKGRDHARTPMQWDAGK-HAGF-T--AGDPWIPVNSRYQ-DINVKESLEDQDSIFFYYQKLIQLRKQY-KIMIYGDYQLLQE--NDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELI--HE--R-WKVLISNY-P---Q---AD----L-K---S-IS-LKPYEAVMGIS----
7 PsiBlast_PDB 70.1047% -52 - C1 -4M8U O16G1_BACSU A:[2-554] --SEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDN-GYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAE-SRKSKDNPYRDYYLW--KDPKP------D-GS-EPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYD-VMRFWM-DRGVDGWRMDAIGS------ISKYTDFPD--------YE--TD------------HS-RS----YIVGRYH--------SNGPRLHEFIQE----MNREVLSHYDCMTVGEANGSDIEE-AKKYTDASRQELNMIFTFEHMDIDKEQN--SPNGKWQ-IKPFDLIALKKTMTRWQTGL-M-N-VGWNTLYFENHDQPRVISRWGNDR-KLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNS--DMP-LEMYDDLEIKNAYRELVVENKTMSEKEF---VKAVM-IKGRDHARTPMQWDAGK-HAGF-T--AGDPWIPVNSRYQ-DINVKESLEDQDSIFFYYQKLIQLRKQYKIM-IYGDYQLLQE--NDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELI--HE--R-WKVLISNY-P---E-R-AD----L-K---S-IS-LKPYEA---------
110 HHSearch 69.9248% -58 - C1 -4AIE ? A:[4-540] --ASWWKNAVVYQVYPKSFQDSNGDGIGDLQGIISRLDYLEKLGIDAIWLSPVYQSPGVDN-GYDISDYEAIDPQYGTMADMDELISKAKEHHIKIVMDLVVNHTSDQHKWFVE-AKKGKDNQYRDYYIW--R-DPV------D-EH-EPNDLKSAFSGSAWKYDERSGQYYLHFFADQQPDLNWQNTELRQKIYN-MMNFWL-DKGIGGFRMDVIEL------IGKDPDKN-----------------------------------------IR--------ENGPMLHPYLQE----MNKATFGKRDVMTVGETWNATPKI-AEEYSDPDRHELSMVFQFENQSLDQQPG--KEK--WD-LKPLDLGELKKVLVKWQTKIDF-D-HAWNSLFWENHDIPRVISRWGNDQ-EYRVQCAKMFAIILHMMHGTPYIFNGEEIGMTNC--PVKNIDEVEDIESINMYNERLA--EGYDEEEL---IHAIN-VKGRDNARRPMQWNDEK-NAGF-S--EVDPWLSVNPNYK-DINVENALADPNSIFYTYQKLIKLRHEN-PIVVDGDFSLVSN--TQDAVLAYYRILNDKKWLVVANLSNEEQNFVSNDQ----------IETILSNY-P---E-R-NN----V-Q---N-IT-LKPYEAFISKVI---
26 PsiBlast_CBE 69.7848% -63 - C1 -5BRP ? B:[14-566] ----WWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN-GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKE-AASGKENLYRDFYIW--K-DMK------P-NGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYE-MMHFWF-EKGIDGFQLDVINV------ISKDQRFPD---------------------------D-DE----GDGRRFY--------TDGPRVHEFLNE----MNREVFSKYDSMTVGEMSSTTIAD-CIRYTNPESRELDMVFNFHHLKAD-YPN--GEK--WA-LADFDFLKLKKILSEWQTEMNK-G-GGWNALFWCNHDQPRIVSRYGDDG-KYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNP--KFDDISLYRDVESLNMY--RILK-EAGKPEAE---IIEILKAKSRDNSRTPVQWNGEE-NAGF-T--AGTPWIPVPDNYK-EINAEEALNDPDSIFYHYKKLNELRKEFDII-TTGDYQLILE--DDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDID--IEGYD-AKVLIS---N---D-T-DL----P-ESFKR-FT-VKPYQSIVYHLAK--
9 PsiBlast_PDB 69.6547% -59 - C1 -4AIE ? A:[6-536] ----WWKNAVVYQVYPKSFQDSNGDGIGDLQGIISRLDYLEKLGIDAIWLSPVYQSPGVDN-GYDISDYEAIDPQYGTMADMDELISKAKEHHIKIVMDLVVNHTSDQHKWFVE-AKKGKDNQYRDYYIW--R-DPV------D-EH-EPNDLKSAFSGSAWKYDERSGQYYLHFFADQQPDLNWQNTELRQKIYN-MMNFWL-DKGIGGFRMDVIEL------IGKD-----------------------------------------PDKNIR--------ENGPMLHPYLQE----MNKATFGKRDVMTVGETWNATPKI-AEEYSDPDRHELSMVFQFENQSLDQQPG--KEK--WD-LKPLDLGELKKVLVKWQTKI-D-FDHAWNSLFWENHDIPRVISRWGNDQ-EYRVQCAKMFAIILHMMHGTPYIFNGEEIGMTNC--PVKNIDEVEDIESINMYNERLAE--GYDEEEL---IHAIN-VKGRDNARRPMQWNDEK-NAGF-S--EVDPWLSVNPNYK-DINVENALADPNSIFYTYQKLIKLRHENPIV-VDGDFSLVSN--TQDAVLAYYRILNDKKWLVVANLSNEEQNF-----VS--ND--Q-IETILSNY-P---E-R-NN----V-Q---N-IT-LKPYEAFI-------
5 PsiBlast_PDB 69.4347% -52 - C1 -4MAZ O16G1_BACSU A:[3-555] ---EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDN-GYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAE-SRKSKDNPYRDYYLW--KDPKP------D-GS-EPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYD-VMRFWM-DRGVDGWRMDSIGS------ISKYTDFPD--------YE--TD------------HS-RS----YIVGRYH--------SNGPRLHEFIQE----MNREVLSHYDCMTVGEANGSDIEE-AKKYTDASRQELNMIFTFEHMDIDKEQN--SPNGKWQ-IKPFDLIALKKTMTRWQTGL-M-N-VGWNTLYFENHDQPRVISRWGNDR-KLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNS--DMP-LEMYDDLEIKNAYRELVVENKTMSEKEF---VKAVM-IKGRDHARTPMQWDAGK-HAGF-T--AGDPWIPVNSRYQ-DINVKESLEDQDSIFFYYQKLIQLRKQYKIM-IYGDYQLLQE--NDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELI--HE--R-WKVLISNY-P---Q-E-RA----DLK---S-IS-LKPYEA---------
8 PsiBlast_PDB 69.3347% -54 - C1 -4MB1 O16G1_BACSU A:[3-555] ---EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDN-GYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAE-SRKSKDNPYRDYYLW--KDPKP------D-GS-EPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYD-VMRFWM-DRGVDGWRMDVIPS------ISKYTDFPD--------YE--TD------------HS-RS----YIVGRYH--------SNGPRLHEFIQE----MNREVLSHYDCMTVGEANGSDIEE-AKKYTDASRQELNMIFTFEHMDIDKEQN--SPNGKWQ-IKPFDLIALKKTMTRWQTGL-M-N-VGWNTLYFENHDQPRVISRWGNDR-KLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNS--DMP-LEMYDDLEIKNAYRELVVENKTMSEKEF---VKAVM-IKGRDHARTPMQWDAGK-HAGF-T--AGDPWIPVNSRYQ-DINVKESLEDQDSIFFYYQKLIQLRKQYKIM-IYGDY