@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu03130: (2016-06-05 )
MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK

Atome Classification :

(33 SA) .........10......----..20........30......-.-.40........50........60........-70-.--.--...--...80...--.....90......-..--100.......110.......120..--...--..--130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
4 PsiBlast_PDB 87.02100% -40 - C5 -1FYD NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
23 PsiBlast_CBE 86.80100% -34 - C5 -1KQP NADE_BACSU B:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
43 HHSearch 86.58100% -39 - C5 -1KQP NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
7 PsiBlast_PDB 86.58100% -39 - C5 -1KQP NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
21 PsiBlast_CBE 86.39100% -37 - C5 -2NSY NADE_BACSU B:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
1 PsiBlast_PDB 86.14100% -38 - C5 -1NSY NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
64 Fugue 86.11100% -37 - C5 -2NSY NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
2 PsiBlast_PDB 86.11100% -37 - C5 -2NSY NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
22 PsiBlast_CBE 85.84100% -37 - C5 -1NSY NADE_BACSU B:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
6 PsiBlast_PDB 85.31100% -30 - C5 -1IH8 NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
3 PsiBlast_PDB 84.87100% -32 - C5 -1EE1 NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHGT--QQDEDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
29 PsiBlast_CBE 80.8777% -43 - C5 -2PZ8 NADE_BACAN B:[1-272] MTLQEQIMKALHVQPVI----DPKAEIRKRVDFLKDYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVEEIRNE-GG-N--A--TFI--AVRLPYKV--QKDEDDAQLALQF-IQ--ADQSVAFDIASTVDAFSNQYENLLD--ESL--TD--FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
26 PsiBlast_CBE 80.84100% -69 - C5 -1EE1 NADE_BACSU B:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHG------EDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYL---------------------ISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
28 PsiBlast_CBE 80.6577% -40 - C5 -2PZA NADE_BACAN B:[1-272] MTLQEQIMKALHVQPVI----DPKAEIRKRVDFLKDYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVEEIRNE-GG-N--A--TFI--AVRLPYKV--QKDEDDAQLALQF-IQ--ADQSVAFDIASTVDAFSNQYENLLD--ESL--TD--FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
24 PsiBlast_CBE 80.39100% -63 - C5 -1IH8 NADE_BACSU B:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHG------EDDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYL--------------------GISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
8 PsiBlast_PDB 80.3877% -39 - C5 -2PZ8 NADE_BACAN A:[1-272] MTLQEQIMKALHVQPVI----DPKAEIRKRVDFLKDYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVEEIRNE-GG-N--A--TFI--AVRLPYKV--QKDEDDAQLALQF-IQ--ADQSVAFDIASTVDAFSNQYENLLD--ESL--TD--FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
25 PsiBlast_CBE 79.40100% -73 - C5 -1IFX NADE_BACSU B:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHG-------DDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYL---------------------ISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
9 PsiBlast_PDB 79.3377% -38 - C5 -2PZA NADE_BACAN A:[1-272] MTLQEQIMKALHVQPVI----DPKAEIRKRVDFLKDYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVEEIRNE-GG-N--A--TFI--AVRLPYKV--QKDEDDAQLALQF-IQ--ADQSVAFDIASTVDAFSNQYENLLD--ESL--TD--FNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWK
5 PsiBlast_PDB 78.72100% -68 - C5 -1IFX NADE_BACSU A:[1-271] -SMQEKIMRELHVKPSI----DPKQEIEDRVNFLKQYVKKT-G-AKGFVLGISGGQDSTLAGRLAQLAVESIREE-GG-D--A--QFI--AVRLPHG-------DDAQLALKF-IK--PDKSWKFDIKSTVSAFSDQYQQETG--DQL--TD--FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYL---------------------ISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
46 HHSearch 75.8558% -57 - C5 -4Q16 NADE_DEIRA A:[10-280] -PLRSHIIRELHVQPDI----DPGAEVERRVAFLCDYLQST-P-TKGFVLGISGGQDSTLAGRLCQLAVERRRSQ-GH-G--A--TFL--AVRLPYGV--QADEADAQQALDF-IQ--ADREVTVNIKEAADASVAAAQAALG--SEV--RD--FVRGNVKARERMVAQYALAGQENLLVVGTDHAAEALTGFYTKYGDGGVDLTPLSGLTKRQGAQLLAHLGAPEGTWRKVPTADL----PGLPDEVALGVTYAQIDAYLEGREVSDEAAARLERLFLNSRHKRALPVTPFDGWWQ
20 PsiBlast_PDB 72.0248% -88 - C5 -5F23 NADE_PSEAE A:[12-280] --IQRDIAQALQVQPPFQSEADVQAQIARRIAFIQQCLKDS-G-LKTLVLGISGGVDSLTAGLLAQRAVEQLREQ-TG-D--QAYRFI--AVRLPYQV--QQDEADAQASLAT-IR--ADEEQTVNIGPSVKALAEQLEALEG--LEPAKSD--FVIGNIKARIRMVAQYAIAGARGGLVIGTDHAAEAVMGFFTKFGDGACDLAPLSGLAKHQVRALARALGAPENLVEKI-----------------HGVTYAEIDAFLHGQPLREEAARVIVDTYHKTQHKRELP---------
11 PsiBlast_PDB 71.2354% -77 - C5 -1WXE NADE_ECOLI A:[2-274] -TLQQQIIKALGAKPQI----NAEEEIRRSVDFLKSYLQTY-PFIKSLVLGISGGQDSTLAGKLCQMAINELRLE-TG-NESL--QFI--AVRLPYGV--QADEQDCQDAIAF-IQ--PDRVLTVNIKGAVLA-SEQALREAG--IEL--SD--FVRGNEKARERMKAQYSI