@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu03410: (2016-06-05 )
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGEIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDILAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIEAGDMDLLAKGKPDFVGVNYYQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGESL

Atome Classification :

(66 SA) .........10........20........30........40.-------------.-------------....--------.----------.----50-.------.---...-------....60........70........80........90.-.--..-....100.......110.......120.......130...-...---.140.......150.......160.......170--..-------.-----....180----.-----.-------.--.....------------.---------190----------....-.....200.......210.---..--.---...-220.......230....-...240.......250........260...-....270..-.....280....-.-.-.-290.-......300....----...310.......320...-....--330.......340.......350-.-......360.......370.-.-......380.----..-.-----.--.-----.--390.......400.......410-.-......420.......430..-.-....440.......450.......460.......470.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFT-------------K-------------IPGK--------T----------F----K--G------T---NGE-------IAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKG-K--GE-INEAGLAFYDSLIDELLSHHIEPVLTLYHWDLPQALMDEY-GGF---ESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQN--YN-------F-----NHGFI------T-----A-------M--HPPGV------------K---------D------------RKRF-YEANHIAFLANAKAIESFR---EY--V---PEG-KIGPSFAYSPAYPLSSH-PEDILAFENAEEFTN-NWWLDMYCWGTYPQ-IPFRCLEKQ-GWAPTIEAGDMD-L-L-A-KGKP-DFVGVNYYQTITY----ERNPLDGVSEGKMNTTGQK-GTNQ--ETGIPGVFKTKKNPHLTTSNWDW-T-IDPIGLRIGLRRITSRY-QL-P-VFITENGLGE----FD-K-----V--E-----D--GTVQDDYRIDYLRSHLEQCRQAI-S-DGVDLIGYCSWSFTDLLSWLN-G-YQKRYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGESL
3 PsiBlast_PDB 96.0040% -99 - C3 -4F79 ? A:[7-480] --------LPENFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR-----E-------------ITAG--------V----------L----E--G------KYYPNHE--------AIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AE-PNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEY-GGF---TNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQAN-------Y-----QEDFA------PFTNSGI-------V--YKEGD------------D---------R------------EAIM-YQAAHYELVASARAVKIGH---AI--N---PNL-NIGCMVAMCPIYPATCN-PKDILMAQKAMQ-KR-YYFADVHVHGFYPE-HIFKYWERK-AIKVDFTERDKK-D-L-F-EGTV-DYIGFSYYMSFVIDAHRENNPYYDYLETE----------------------DLVKNPYVKASDWDW-Q-IDPQGLRYALNWFTDMY-HL-P-LFIVQNGFGA----ID-Q-----V--EA----D--GMVHDDYRIDYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGT-GEMRKRYGFIYVDKDDEGKGTLKRSPKLSFNWYKEVIASNGDDI
25 PsiBlast_CBE 95.4640% -99 - C3 -4GPN ? B:[7-480] --------LPENFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR-----E-------------ITAG--------V----------L----E--G------KYYPNHE--------AIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AE-PNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEY-GGF---TNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQAN-------Y-----QEDFA------PFTNSGI-------V--YKEGD------------D---------R------------EAIM-YQAAHYELVASARAVKIGH---AI--N---PNL-NIGCMVAMCPIYPATCN-PKDILMAQKAMQ-KR-YYFADVHVHGFYPE-HIFKYWERK-AIKVDFTERDKK-D-L-F-EGTV-DYIGFSYYMSFVIDAHRENNPYYDYLETE----------------------DLVKNPYVKASDWDW-Q-IDPQGLRYALNWFTDMY-HL-P-LFIVQNGFGA----ID-Q-----V--EA----D--GMVHDDYRIDYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGT-GEMRKRYGFIYVDKDDEGKGTLKRSPKLSFNWYKEVIASNGDDI
24 PsiBlast_CBE 94.7140% -95 - C3 -4F66 ? B:[7-480] --------LPENFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR-----E-------------ITAG--------V----------L----E--G------KYYPNHE--------AIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AE-PNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEY-GGF---TNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQAN-------Y-----QEDFA------PFTNSGI-------V--YKEGD------------D---------R------------EAIM-YQAAHYELVASARAVKIGH---AI--N---PNL-NIGCMVAMCPIYPATCN-PKDILMAQKAMQ-KR-YYFADVHVHGFYPE-HIFKYWERK-AIKVDFTERDKK-D-L-F-EGTV-DYIGFSYYMSFVIDAHRENNPYYDYLETE----------------------DLVKNPYVKASDWDW-Q-IDPQGLRYALNWFTDMY-HL-P-LFIVENGFGA----ID-Q-----V--EA----D--GMVHDDYRIDYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGT-GEMRKRYGFIYVDKDDEGKGTLKRSPKLSFNWYKEVIASNGDDI
4 PsiBlast_PDB 94.2340% -96 - C3 -4GPN ? A:[7-480] --------LPENFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR-----E-------------ITAG--------V----------L----E--G------KYYPNHE--------AIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AE-PNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEY-GGF---TNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQAN-------Y-----QEDFA------PFTNSGI-------V--YKEGD------------D---------R------------EAIM-YQAAHYELVASARAVKIGH---AI--N---PNL-NIGCMVAMCPIYPATCN-PKDILMAQKAMQ-KR-YYFADVHVHGFYPE-HIFKYWERK-AIKVDFTERDKK-D-L-F-EGTV-DYIGFSYYMSFVIDAHRENNPYYDYLETE----------------------DLVKNPYVKASDWDW-Q-IDPQGLRYALNWFTDMY-HL-P-LFIVQNGFGA----ID-Q-----V--EA----D--GMVHDDYRIDYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGT-GEMRKRYGFIYVDKDDEGKGTLKRSPKLSFNWYKEVIASNGDDI
19 PsiBlast_PDB 94.0438% -95 - C3 -3QOM ? A:[10-480] -------AFPEGFLWGGAVAAHQLEGGYKEGGKGLSTADIMTLGTNERPREITDGV-------------VAGK--------Y----------Y----P--N------H---Q----------AIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDE--SE-PNEAGLQFYDDLFDECLKNGIQPVVTLAHFEMPYHLVKQY-GGW---RNRKLIQFYLNFAKVCFERYRDKVTYWMTFNEIN--NQ-------T-----NFESD------G-----AMLTDSGII--HQPGE------------N---------R------------ERWM-YQAAHYELVASAAAVQLGH---QI--N---PDF-QIGCMIAMCPIYPLTAA-PADVLFAQRAMQ-TR-FYFADVHCNGTYPQ-WLRNRFESE-HFNLDITAEDLK-I-L-Q-AGTV-DYIGFSYYMSFT-----------------VKDTGKL-AYNE--EHDL------VKNPYVKASDWGW-Q-VDPVGLRYAMNWFTDRY-HL-P-LFIVENGLGA----IDKK-----T--A-----D--NQIHDDYRIDYLTDHLRQIKLAVLE-DGVDLIGYTPWGCIDLVAAST-GQMSKRYGFIYVDENDDGSGSLKRYKKDSFTWFQHVIATNGAEI
2 PsiBlast_PDB 93.8640% -94 - C3 -4F66 ? A:[7-480] --------LPENFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR-----E-------------ITAG--------V----------L----E--G------KYYPNHE--------AIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AE-PNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEY-GGF---TNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQAN-------Y-----QEDFA------PFTNSGI-------V--YKEGD------------D---------R------------EAIM-YQAAHYELVASARAVKIGH---AI--N---PNL-NIGCMVAMCPIYPATCN-PKDILMAQKAMQ-KR-YYFADVHVHGFYPE-HIFKYWERK-AIKVDFTERDKK-D-L-F-EGTV-DYIGFSYYMSFVIDAHRENNPYYDYLETE----------------------DLVKNPYVKASDWDW-Q-IDPQGLRYALNWFTDMY-HL-P-LFIVENGFGA----ID-Q-----V--EA----D--GMVHDDYRIDYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGT-GEMRKRYGFIYVDKDDEGKGTLKRSPKLSFNWYKEVIASNGDDI
108 HHSearch 93.5641% -92 - C3 -3QOM ? A:[5-480] --TIKGRAFPEGFLWGGAVAAHQLEGGYKEGGKGLSTADIMT-------------L-------------GTNERPRE----I----------T----D--GVVAGKYY---PNH-------QAIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNG-DE-SE-PNEAGLQFYDDLFDECLKNGIQPVVTLAHFEMPYHLVKQY-GGW---RNRKLIQFYLNFAKVCFERYRDKVTYWMTFNEIN--NQ-------T-----NFESDGAMLTDS-----GI------I--HQPGE------------N---------R------------ERWM-YQAAHYELVASAAAVQLGH---QI--N---PDF-QIGCMIAMCPIYPLTAA-PADVLFAQRAMQTRF--YFADVHCNGTYPQ-WLRNRFESE-HFNLDITAEDLK-I-LQA-G-TV-DYIGFSYYMSFTV----KDTGKLAYN------EEH----------DL------VKNPYVKASDWGW-Q-VDPVGLRYAMNWFTDRY-HL-P-LFIVENGLGA----ID-K-----KT-A-----D--NQIHDDYRIDYLTDHLRQIKLAVLE-DGVDLIGYTPWGCIDLVAAST-GQMSKRYGFIYVDENDDGSGSLKRYKKDSFTWFQHVIATNGAEI
20 PsiBlast_PDB 93.3138% -94 - C3 -4GZE ? A:[10-480] -------AFPEGFLWGGAVAAHQLEGGYKEGGKGLSTADIMTLGTNERPREITDGV-------------VAGK--------Y----------Y----P--N------H---Q----------AIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDE--SE-PNEAGLQFYDDLFDECLKNGIQPVVTLAHFEMPYHLVKQY-GGW---RNRKLIQFYLNFAKVCFERYRDKVTYWMTFNEIN--NQ-------T-----NFESD------G-----AMLTDSGII--HQPGE------------N---------R------------ERWM-YQAAHYELVASAAAVQLGH---QI--N---PDF-QIGCMIAMCPIYPLTAA-PADVLFAQRAMQ-TR-FYFADVHCNGTYPQ-WLRNRFESE-HFNLDITAEDLK-I-L-Q-AGTV-DYIGFSYYMSFT-----------------VKDTGKL-AYNE--EHDL------VKNPYVKASDWGW-Q-VDPVGLRYAMNWFTDRY-HL-P-LFIVENGLGA----IDKK-----T--A-----D--NQIHDDYRIDYLTDHLRQIKLAVLE-DGVDLIGYTPWGCIDLVAAST-GQMSKRYGFIYVDENDDGSGSLKRYKKDSFTWFQHVIATNGAEI
13 PsiBlast_PDB 91.2840% -89 - C3 -3PN8 ? A:[7-480] --------LPENFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR-----E-------------ITAG--------V----------L----E--G------KYYPNHE--------AIDFYHHYKEDVKLFAEMGFKCFRTSIAWTRIFPKGDE--AE-PNEAGLQFYDDLFDECLKYGIEPVVTLSHFELPYHLVTEY-GGF---TNRKVIDFFVHFAEVCFRRYKDKVKYWMTFNEINNQAN-------Y-----QEDFA------P-----F-------T--NSGIVYKEG--------D---------D------------REAIMYQAAHYELVASARAVKIGH---AI--N---PNL-NIGCMVAMCPIYPATCN-PKDILMAQKAMQ-KR-YYFADVHVHGFYPE-HIFKYWERK-AIKVDFTERDKK-D-L-F-EGTV-DYIGFSYYMSFVI----DAHRENNPYYDYLETE------------------DLVKNPYVKASDWDW-Q-IDPQGLRYALNWFTDMY-HL-P-LFIVENGFGA----ID-Q-----V--EA----D--GMVHDDYRIDYLGAHIKEMIKAVDE-DGVELMGYTPWGCIDLVSAGT-GEMRKRYGFIYVDKDDEGKGTLKRSPKLSFNWYKEVIASNGDDI
21 PsiBlast_CBE 89.8039% -90 - C3 -2XHY BGLA_ECOLI D:[7-479] -------TLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLT-------------GGAHGVPREITKEVLPGK--------Y----------Y----P--N------H---E----------AVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDE--AQ-PNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQY-GSW---TNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN--NQRNWRAPLF-----GYCCS------G-----V-------V--YTEHE------------N---------P------------EETM-YQVLHHQFVASALAVKAAR---RI--N---PEM-KVGCMLAMVPLYPYSCN-PDDVM-FAQESMRER-YVFTDVQLRGYYPS-YVLNEWERR-GFNIKMEDGDLD-V-L-R-EGTC-DYLGFSYYMTNAV----K-------AEG-----------------SVP-------NPYVKASDWGW-Q-IDPVGLRYALCELYERY-QR-P-LFIVENGFGA----YD-K-----VE-E-----D--GSINDDYRIDYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTT-GQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
118 HHSearch 89.7742% -86 - C3 -2XHY BGLA_ECOLI A:[4-479] ----KKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLT-------------G-------------GAHG--------VPREITKEVLPG----K--Y------Y---PNH-------EAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKG-DE-AQ-PNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQY-GSW---TNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN--NQ-------RNWRAPLFGYC------CS----G-------V--VYTEH------------E---------NP-----------EETM-YQVLHHQFVASALAVKAAR---RI--N---PEM-KVGCMLAMVPLYPYSCN-PDDVMFAQESMRE-R-YVFTDVQLRGYYPS-YVLNEWERR-GFNIKMEDGDLD-VLR-E-G-TC-DYLGFSYYMTNAV----KAEGGT-----------------F--EGSV-------PNPYVKASDWGW-Q-IDPVGLRYALCELYERY-QR-P-LFIVENGFGA----YD-K-----VE-E-----D--GSINDDYRIDYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTT-GQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
1 PsiBlast_PDB 88.0739% -87 - C3 -2XHY BGLA_ECOLI A:[7-479] -------TLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLT-------------GGAHGVPREITKEVLPGK--------Y----------Y----P--N------H---E----------AVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDE--AQ-PNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQY-GSW---TNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN--NQRNWRAPLF-----GYCCS------G-----V-------V--YTEHE------------N---------P------------EETM-YQVLHHQFVASALAVKAAR---RI--N---PEM-KVGCMLAMVPLYPYSCN-PDDVM-FAQESMRER-YVFTDVQLRGYYPS-YVLNEWERR-GFNIKMEDGDLD-V-L-R-EGTC-DYLGFSYYMTNAV----K-------AEG---GT-------F--EGSVP-------NPYVKASDWGW-Q-IDPVGLRYALCELYERY-QR-P-LFIVENGFGA----YD-K-----VE-E-----D--GSINDDYRIDYLRAHIEEMKKAV-TYDGVDLMGYTPWGCIDCVSFTT-GQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL