@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu03730: (2016-06-06 )
MSLLQFQQVGYWYKNKSQPLFQDINISFQKGKFYTIVGTSGTGKTTFLSLAGGLDAPKEGNILYDGKAVSKIGLTNFRNQYVSIVFQAYNLLPYMTALQNVTTAMEITGSKEKNKESYALDMLQKVGINEKQARQKVLTLSGGQQQRVSITRAFCCDTDLIVADEPTGNLDEDTSKEIVRLFQDLAHKEDKCVIMVTHDEQIAKVSDINIRLSRGSFTVKENVAVV

Atome Classification :

(45 SA) -.........10...--.-.--...20-.--........30........40........50........60.....-------------...70-.-..---....--.--.--80-.......-..90........100..-.------...--.110-....----...120....--...130--------.........140.......150.......160.......170.......180.......190.......-200..-.-....210.......220....----------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MSLLQFQQVGYWYK--N-K--SQPL--F--QDINISFQKGKFYTIVGTSGTGKTTFLSLAGGLDAPKEGNILYDG-------------KAVS--K-IG---LTNF--R--N--Q--YVSIVFQ-AYNLLPYMTALQNVTTA-M------EIT--GSKE-KNKE----SYALDMLQKV--GINE----------KQARQKVLTLSGGQQQRVSITRAFCCDTDLIVADEPTGNLDEDTSKEIVRLFQDLAHKEDKCVIMVTHD-EQIAK-V-SDINIRLSRGSFTVKENVAVV----------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 84.0134% -97 - C1 -1F3O Y796_METJA A:[2-229] ----IKLKNVTKTYK--M-G--EEII--YALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN-------------IKTN--D-LDDDELTKI--R--R--D--KIGFVFQ-QFNLIPLLTALENVELP-LIF----KYR--GAMSGEERR----KRALECLKMA--ELEE----------RFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHD-INVAR-F-GERIIYLKDGEVEREEKL-------------------------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 82.4133%-104 - C1 -1L2T Y796_METJA B:[1-229] ---MIKLKNVTKTYK--M-G--EEII--YALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN-------------IKTN--D-LDDDELTKI--R--R--D--KIGFVFQ-QFNLIPLLTALENVELP-LIFKYRGAMS--GEER-RKR-------ALECLKMA--ELEE----------RFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHD-INVAR-F-GERIIYLKDGEVEREEKL-------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 80.3832%-108 - C1 -3TIF Y796_METJA B:[1-229] ---MVKLKNVTKTYK--M-G--EEII--YALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN-------------IKTN--D-LDDDELTKI--R--R--D--KIGFVFQ-QFNLIPLLTALENVELP-LIFKYRGAMS--GEER-RKR-------ALECLKMA--ELEE----------RFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLNEEDGKTVVVVTHD-INVAR-F-GERIIYLKDGEVEREEKL-------------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 76.9534%-122 - C1 -4U02 ? C:[3-206] --PIIRIRNLHKWFG---------PLHVL--KGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDG-------------LSVK--DDRA---LREI--R--R--E---VGMVFQ-QFNLFPHMTVLENVTLAPM------RVR--RWPR-EKAE----KKALELLERV--GILD-----------QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-GMTMVVVTHE-MGFAREV-AD-----------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 75.5133% -97 - C1 -1L2T Y796_METJA A:[1-229] ---MIKLKNVTKTYK--M-G--EEII--YALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN-------------IKTN--D-LDDDELTKI--R--R--D--KIGFVFQ-QFNLIPLLTALENVELP-LIFKYRGAMS--GEER-RKR-------ALECLKMA--ELEE----------RFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHD-INVAR-F-GERIIYLKDGEVEREEKL-------------------------------------------------------------------------------------------------------------------------------
28 PsiBlast_CBE 75.0334%-115 - C1 -4U02 ? B:[3-206] --PIIRIRNLHKWFG---------PLHVL--KGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDG-------------LSVK--DDRA---LREI--R--R--E---VGMVFQ-QFNLFPHMTVLENVTLAPM------RVR--RWPR-EKAE----KKALELLERV--GILD-----------QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-GMTMVVVTHE-MGFAREV-AD-----------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 74.6934%-113 - C1 -4U02 ? D:[3-206] --PIIRIRNLHKWFG---------PLHVL--KGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDG-------------LSVK--DDRA---LREI--R--R--E---VGMVFQ-QFNLFPHMTVLENVTLAPM------RVR--RWPR-EKAE----KKALELLERV--GILD-----------QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-GMTMVVVTHE-MGFAREV-AD-----------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 73.8734%-117 - C1 -4U00 ? A:[3-206] --PIIRIRNLHKWFG---------PLHVL--KGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDG-------------LSVK--DDRA---LREI--R--R--E---VGMVFQ-QFNLFPHMTVLENVTLAPM------RVR--RWPR-EKAE----KKALELLERV--GILD-----------QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-GMTMVVVTHE-MGFAREV-AD-----------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 73.8532%-101 - C1 -3TIF Y796_METJA A:[1-229] ---MVKLKNVTKTYK--M-G--EEII--YALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN-------------IKTN--D-LDDDELTKI--R--R--D--KIGFVFQ-QFNLIPLLTALENVELP-LIFKYRGAMS--GEER-RKR-------ALECLKMA--ELEE----------RFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLNEEDGKTVVVVTHD-INVAR-F-GERIIYLKDGEVEREEKL-------------------------------------------------------------------------------------------------------------------------------
82 Fugue 73.2726%-115 - C1 -1Z47 ? A:[11-355] GSMTIEFVGVEKIYP--G-G--AR-S--V--RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGG-------------KRVT--D-L------PP--Q--K--R--NVGLVFQ-NYALFQHMTVYDNVSFG-L------REK--RVPK-DEMD----ARVRELLRFM--RL-E----------SYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHD-QEEAL-EVADRVLVLHEGNVEQFGTPEEVYEKPGTLFVASFIGESNVWTRAVQNGRIEVAGAALPVDPAVSEGSEVAVVVRPKDVELQPASEREAHAQVVRSAFKGSYSACWIRTKDGEVWEVHVPSADRHRWSPGAWVHMNVTRWFIFPR--
84 Fugue 72.8924%-135 - C1 -3TUZ METN_ECOLI H:[23-362] --HMIKLSNITKVFHQGT-R--TIQA--L--NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDG-------------QELT--T-LS---ESEL--T--KARR--QIGMIFQ-HFNLLSSRTVFGNVALP-L------ELD--NTPK-DEVK----RRVTELLSLV--GLGD----------KH-DSYPSNLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKR-I-CDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEV-------------
12 PsiBlast_PDB 72.4634%-109 - C1 -4U02 ? A:[3-206] --PIIRIRNLHKWFG---------PLHVL--KGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDG-------------LSVK--DDRA---LREI--R--R--E---VGMVFQ-QFNLFPHMTVLENVTLAPM------RVR--RWPR-EKAE----KKALELLERV--GILD-----------QARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQG-GMTMVVVTHE-MGFAREV-AD-----------------------------------------------------------------------------------------------------------------------------------------------
80 Fugue 71.4125%-121 - C1 -1OXS ? C:[1-352] -MVRIIVKNVSKVFK--K-G--KVVA--L--DNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDD-------------RLVA--S-NG---KLIV--P--P--EDRKIGMVFQ-TWALYPNLTAFENIAFP-L------TNM--KMSK-EEIR----KRVEEVAKIL--DI-H----------HVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHD-PADIF-AIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
9 PsiBlast_PDB 71.2935%-115 - C1 -4YMV ? J:[8-200] -------------YK--NFG--SLEV--L--KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDG-------------VKINNGK-VN---INKV--R-----Q--KVGMVFQ-HFNLFPHLTAIENITLAPV------KVK--KMNK-KEAE----ELAVDLLAKV--GLLD----------KK-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLAN-EGMTMVVVTHE-MGFAR----------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 71.0735%-112 - C1 -4YMV ? A:[8-200] -------------YK--NFG--SLEV--L--KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDG-------------VKINNGK-VN---INKV--R-----Q--KVGMVFQ-HFNLFPHLTAIENITLAPV------KVK--KMNK-KEAE----ELAVDLLAKV--GLLD----------KK-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLAN-EGMTMVVVTHE-MGFAR----------------------------------------------------------------------------------------------------------------------------------------------------
77 HHSearch 70.9925%-130 - C1 -4MRS ATM1_NOVAD A:[360-579] ---SVTFDNVVFGYD--R----DREI--L--HGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRILIDG-------------QDIA--H-VT---QTSL--R-----A--ALGIVPQ-DSVLFN-DTIGYNIAYG-R------DGA--S-------R----AEVDAAAKGA--AIADFIARLPQGYDTEVGERGLKLSGGEKQRVAIARTLVKNPPILLFDEATSALDTRTEQDILSTMRAVA--SHRTTISIAHR-LSTIA-D-SDTILVLDQGRLAEQGSH-------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 70.9635%-116 - C1 -4YMU ? A:[8-200] -------------YK--NFG--SLEV--L--KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDG-------------VKINNGK-VN---INKV--R-----Q--KVGMVFQ-HFNLFPHLTAIENITLAPV------KVK--KMNK-KEAE----ELAVDLLAKV--GLLD----------KK-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLAN-EGMTMVVVTHE-MGFAR----------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 70.8635%-115 - C1 -4YMS - ? J:[8-200] -------------YK--NFG--SLEV--L--KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDG-------------VKINNGK-VN---INKV--R-----Q--KVGMVFQ-HFNLFPHLTAIENITLAPV------KVK--KMNK-KEAE----ELAVDLLAKV--GLLD----------KK-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLAN-EGMTMVVVTHE-MGFAR----------------------------------------------------------------------------------------------------------------------------------------------------
69 HHSearch 70.5024%-132 - C1 -3TUI METN_ECOLI C:[23-248] --HMIKLSNITKVFH--Q-GTRTIQA--L--NNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDG-------------QELT--T-LS---ESELTKA--R--R--QIGMIFQ-HFNLLSSRTVFGNVALP-L------ELD--NTPK-DEVK----RRVTELLSLV--GLGD-----------KHDSYPSNLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTILLITHE-MDVVKRI-CDCVAVISNGELIEQDTV-------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 69.9335%-114 - C1 -4YMT - ? J:[8-200] -------------YK--NFG--SLEV--L--KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDG-------------VKINNGK-VN---INKV--R-----Q--KVGMVFQ-HFNLFPHLTAIENITLAPV------KVK--KMNK-KEAE----ELAVDLLAKV--GLLD----------KK-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLAN-EGMTMVVVTHE-MGFAR----------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 67.3735%-110 - C1 -4YMU ? J:[8-200] -------------YK--NFG--SLEV--L--KGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDG-------------VKINNGK-VN---INKV--R-----Q--KVGMVFQ-HFNLFPHLTAIENITLAPV------KVK--KMNK-KEAE----ELAVDLLAKV--GLLD----------KK-DQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLAN-EGMTMVVVTHE-MGFAR----------------------------------------------------------------------------------------------------------------------------------------------------
54 PsiBlast_CBE 64.4932%-139 - C1 -4HLU ECFA1_THEMA D:[26-216] -------------------------V--L--KDVNAEFETGKIYVVVGKNGSGKTTLLKILAGLLAAA-GEIFLDG-------------SPAD--P-FL---L--------R--K--NVGYVFQNPSSQIIGATVEEDVAFS-L------EIM--GLDE-SEMR----KRIKKVLELV--GLSG----------LAAADP-LNLSGGQKQRLAIASMLARDTRFLALDEPVSMLDPPSQREIFQVLESLKN-EGKGIILVTHE-LEYLD-D-MDFILHISNGT--------------------------------------------------------------------------------------------------------------------------------------
38 PsiBlast_CBE 64.1833%-113 - C1 -3C41 ? K:[15-219] ----------------------SLEV--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 63.9333%-124 - C1 -2OLJ ? A:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
34 PsiBlast_CBE 63.1833%-117 - C1 -2OLK ? D:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
55 PsiBlast_CBE 61.8432%-138 - C1 -4HLU ECFA1_THEMA C:[26-216] -------------------------V--L--KDVNAEFETGKIYVVVGKNGSGKTTLLKILAGLLAAA-GEIFLDG-------------SPAD--P-FL---L--------R--K--NVGYVFQNPSSQIIGATVEEDVAFS-L------EIM--GLDE-SEMR----KRIKKVLELV--GLSG----------LAAADP-LNLSGGQKQRLAIASMLARDTRFLALDEPVSMLDPPSQREIFQVLESLKN-EGKGIILVTHE-LEYLD-D-MDFILHISNGT--------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 60.6833%-115 - C1 -3C4J ? A:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 60.3933%-119 - C1 -2OLK ? A:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
29 PsiBlast_CBE 60.3633%-116 - C1 -3C4J ? B:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
36 PsiBlast_CBE 59.9733%-117 - C1 -2OLK ? B:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 59.3633%-117 - C1 -2Q0H ? A:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
35 PsiBlast_CBE 59.0233%-119 - C1 -2OLK ? C:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
37 PsiBlast_CBE 57.3933%-112 - C1 -2OLJ ? B:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
39 PsiBlast_CBE 57.1637%-112 - C1 -1B0U HISP_SALTY A:[45-229] -----------------------------------------------------KSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVAD--K-NQ---LRLL--R--T--R---LTMVFQ-HFNLWSHMTVLENVMEAPI------QVL--GLSK-HDAR----ERALKYLAKV--GIDE----------RAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLA-EEGKTMVVVTHE-MGFARHV-SSHVIFLHQG---------------------------------------------------------------------------------------------------------------------------------------
30 PsiBlast_CBE 56.5433%-119 - C1 -2Q0H ? B:[39-240] -------------------------V--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 55.4933%-103 - C1 -3C41 ? J:[15-219] ----------------------SLEV--L--KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDG-------------INL---K-AK---DTNL--NKVR--E--EVGMVFQ-RFNLFPHMTVLNNITLAPM------KVR--KWPR-EKAE----AKAMELLDKV--GLKD----------K-AHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLAN-EGMTMVVVTHE-MGFAR-E-VGDRVLFMDGGYIIEE---------------------------------------------------------------------------------------------------------------------------------
53 PsiBlast_CBE 43.8432% - - C1 -3B5Y MSBA_SALTY A:[342-535] ----LEFRNVTFTYP--G-R--EVPA--L--RNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDG-------------HDLR--E-YT---LASL--R--N--Q---VALVSQ-NVHLFNDTVA-NNIAYA-R------TEE--YSRE-QIEEAARMAYAMDFINKMDNGLDT----------IIGENGVL-LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVI---------------------------------------------------------------------------------------------------------------------------------------------------------------
52 PsiBlast_CBE 43.8232% - - C1 -3B5Y MSBA_SALTY B:[342-535] ----LEFRNVTFTYP--G-R--EVPA--L--RNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDG-------------HDLR--E-YT---LASL--R--N--Q---VALVSQ-NVHLFNDTVA-NNIAYA-R------TEE--YSRE-QIEEAARMAYAMDFINKMDNGLDT----------IIGENGVL-LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVI---------------------------------------------------------------------------------------------------------------------------------------------------------------
51 PsiBlast_CBE 43.8132% - - C1 -3B5Y MSBA_SALTY C:[342-535] ----LEFRNVTFTYP--G-R--EVPA--L--RNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDG-------------HDLR--E-YT---LASL--R--N--Q---VALVSQ-NVHLFNDTVA-NNIAYA-R------TEE--YSRE-QIEEAARMAYAMDFINKMDNGLDT----------IIGENGVL-LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVI---------------------------------------------------------------------------------------------------------------------------------------------------------------
50 PsiBlast_CBE 43.8132% - - C1 -3B5Y MSBA_SALTY D:[342-535] ----LEFRNVTFTYP--G-R--EVPA--L--RNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDG-------------HDLR--E-YT---LASL--R--N--Q---VALVSQ-NVHLFNDTVA-NNIAYA-R------TEE--YSRE-QIEEAARMAYAMDFINKMDNGLDT----------IIGENGVL-LSGGQRQRIAIARAL